Tag: Endogenous peptide hormone and apelin receptor (APJ/APLNR) agonist of the apelinergic signaling system

  • Elabela

    Endogenous peptide hormone and apelin receptor (APJ/APLNR) agonist of the apelinergic signaling system

    A 32-amino-acid secreted peptide hormone discovered in 2013 as the second endogenous ligand of the apelin receptor (APJ/APLNR), essential for vertebrate cardiovascular morphogenesis, human embryonic stem cell self-renewal, placental angiogenesis, and renal fluid homeostasis, with preclinical cardioprotective, renoprotective, antihypertensive, and neuroprotective activity across multiple disease models.

    Abstract

    Elabela (ELA), also designated Apela, Toddler, and Ende, is a secreted peptide hormone encoded by the APELA gene on human chromosome 4q32.3. The gene encodes a 54-amino-acid preproprotein containing a 22-residue signal peptide; cleavage yields the 32-amino-acid mature peptide ELA-32 (sequence QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP), which may be further processed by proprotein convertases to generate the bioactive isoforms ELA-21 and ELA-11 [1, 2]. Elabela was discovered independently by two groups in 2013 and 2014: Chng et al. (2013) identified the peptide in zebrafish as a hormone essential for heart development signaling through the apelin receptor (APLNR/APJ), while Pauli et al. (2014) characterized the same molecule as “Toddler,” an embryonic signal promoting mesodermal cell migration [1, 3]. The peptide is the second endogenous ligand of the apelin receptor, a class A G-protein-coupled receptor previously known to bind only apelin; despite sharing a common receptor, Elabela and apelin exhibit less than 25 percent sequence similarity and display distinct spatiotemporal expression profiles and partially divergent signaling bias [4, 5]. Elabela activates the apelin receptor through Gi/o-coupled inhibition of adenylyl cyclase, stimulation of ERK1/2 and PI3K/AKT/mTOR pathways, mobilization of intracellular calcium, and recruitment of beta-arrestin, functioning as a balanced agonist across G-protein-dependent and beta-arrestin-dependent pathways [5, 6]. The binding affinity of ELA-32 for the human apelin receptor is high, with reported IC50 values of approximately 0.27 nanomolar and Kd values of approximately 0.51 nanomolar [7]. Physiologically, Elabela is expressed at high levels during embryogenesis across vertebrate species and in adult tissues with restricted distribution, principally kidney (collecting ducts and loops of Henle), prostate, and vascular endothelium [2, 8]. The peptide is essential for vertebrate cardiovascular development: genetic ablation of Elabela in zebrafish produces severe cardiac malformations including rudimentary or absent hearts, phenocopying loss of the apelin receptor itself [1]. In mice, Elabela knockout produces preeclampsia-like symptoms during pregnancy including proteinuria, hypertension, defective placental angiogenesis, and reduced fetal weight, effects that are rescued by exogenous ELA infusion [9]. A separate demonstration by Ho et al. (2015) established that Elabela is an endogenous growth factor sustaining human embryonic stem cell self-renewal via the PI3K/AKT pathway, with CRISPR-mediated deletion causing loss of pluripotency and cell death [10]. In the adult cardiovascular system, Elabela functions as an endogenous agonist of the apelin receptor producing positive inotropy, vasodilation, increased cardiac output, and depressor responses comparable to apelin; expression is downregulated in pulmonary arterial hypertension, and exogenous administration attenuates right ventricular hypertrophy and pulmonary vascular remodeling in monocrotaline-exposed rats [11]. Preclinical cardioprotective activity has been demonstrated across myocardial infarction, ischemia-reperfusion injury, and hypertensive cardiac fibrosis models, operating through PI3K/AKT-mediated anti-apoptotic, anti-fibrotic, and pro-angiogenic mechanisms [12, 13, 14]. Renoprotective activity is characterized by antagonism of the intrarenal renin-angiotensin system, reduction of blood pressure and albuminuria in salt-sensitive hypertensive rats, and prevention of vasopressin-induced aquaporin-2 translocation in collecting duct principal cells, thereby promoting aqueous diuresis [15, 16]. Neuroprotective activity has been demonstrated in rodent models of ischemic stroke, where ELA attenuates neuronal apoptosis, ferroptosis, and pyroptosis through APJ-dependent signaling cascades [17, 18]. The in vitro plasma half-life of ELA-32 in human plasma is approximately 47 minutes, substantially longer than that of apelin-13 (approximately 5 minutes in vivo), though rapid degradation occurs in kidney homogenates (half-life approximately 44 seconds), and the short systemic half-life has motivated the development of Fc-fusion, PEGylated, and acylated analogs with extended duration of action [19, 20, 21]. No human clinical trials of exogenous Elabela administration have been completed as of the monograph revision date; the compound remains in the preclinical-to-translational research phase. This monograph reviews the chemistry, isoform biology, and synthesis of Elabela; the receptor pharmacology and signaling mechanisms in molecular detail; the pharmacokinetic profile including metabolism and stability-enhancement strategies; the preclinical evidence base across cardiovascular, renal, obstetric, stem cell, neurological, and oncological applications; sourcing and quality verification for research-grade material; reconstitution and handling; stack-interaction considerations; the adverse-event and safety signal from animal studies; and a comparative assessment of five apelinergic system candidates against Elabela on five competency standards.

    Read the full monograph

    The full reference document covers compound identification, discovery and developmental history, mechanism of action, pharmacokinetics, sourcing and quality verification, and a curated reference list. Embedded inline below; download for offline reading.

    KDC-MN-1385Open in new tab →

    Download PDF →

    FOR RESEARCH USE ONLY. Not for medical, diagnostic, or therapeutic purposes. Not for human consumption. All information is provided for research and educational purposes only.