Category: Uncategorized

  • Mecasermin

    Recombinant human insulin-like growth factor 1 (rhIGF-1), a 70-amino-acid single-chain polypeptide with three intramolecular disulfide bonds

    A recombinant analog of endogenous insulin-like growth factor 1 developed at Genentech and commercialized by Tercica (later Ipsen) for the treatment of severe primary IGF-1 deficiency, distinguished from growth hormone replacement by its direct activation of the type 1 IGF-1 receptor and its investigational applications in neuroprotection, neurodevelopmental disorders, and metabolic disease.

    Abstract

    Mecasermin is recombinant human insulin-like growth factor 1 (rhIGF-1), a 70-amino-acid, 7649-dalton non-glycosylated polypeptide produced in Escherichia coli by recombinant DNA technology. The amino acid sequence of mecasermin is identical to that of endogenous human IGF-1, a peptide hormone synthesized principally in the liver under the transcriptional control of growth hormone and serving as the primary mediator of postnatal somatic growth, skeletal maturation, and metabolic homeostasis. Mecasermin is the active pharmaceutical ingredient in Increlex (Ipsen), the only therapy approved by the United States Food and Drug Administration (August 2005, priority review) and by the European Medicines Agency (2007) for the long-term treatment of growth failure in pediatric patients with severe primary insulin-like growth factor 1 deficiency (SPIGFD), a condition most classically represented by Laron syndrome (growth hormone receptor deficiency) and by growth hormone gene deletion with neutralizing antibodies to exogenous growth hormone.

    The mechanism of action is direct agonism of the type 1 IGF-1 receptor (IGF-1R), a transmembrane receptor tyrosine kinase structurally homologous to the insulin receptor. Ligand binding activates autophosphorylation of the intracellular kinase domain and recruitment of insulin receptor substrate (IRS) adapter proteins, leading to bifurcated downstream signaling through the phosphatidylinositol 3-kinase (PI3K)/Akt/mammalian target of rapamycin (mTOR) pathway (metabolic, anti-apoptotic, and translational outcomes) and the Ras/Raf/mitogen-activated protein kinase (MAPK/ERK) pathway (mitogenic, proliferative, and differentiative outcomes). In the growth plate, IGF-1R activation stimulates chondrocyte proliferation and hypertrophy in the proliferative and hypertrophic zones of the epiphyseal cartilage, driving longitudinal bone growth through endochondral ossification. The metabolic actions include stimulation of glucose uptake, amino acid incorporation into protein, fatty acid uptake, and suppression of hepatic glucose output, producing a composite anabolic and mildly hypoglycemic pharmacology.

    Pharmacokinetics following subcutaneous injection are characterized by near-complete bioavailability, a time to peak plasma concentration of approximately 2 hours, and a terminal elimination half-life that is critically dependent on circulating levels of IGF-binding protein 3 (IGFBP-3) and the acid-labile subunit (ALS). In patients with severe primary IGF-1 deficiency, who characteristically have low IGFBP-3 and ALS concentrations, the terminal half-life is approximately 5.8 hours; in healthy individuals with normal binding protein levels, the half-life extends to approximately 19 hours owing to sequestration in the 150-kilodalton ternary complex of IGF-1, IGFBP-3, and ALS. The volume of distribution is approximately 0.257 liters per kilogram. Clearance is inversely proportional to IGFBP-3 concentration and is estimated at 0.04 liters per hour per kilogram at an IGFBP-3 level of 3 micrograms per milliliter. Metabolism is predominantly lysosomal, principally in the liver and kidneys, with degradation to amino acids; less than 0.1 percent of administered drug is excreted unchanged in urine.

    The pivotal clinical evidence base consists of five open-label, single-arm studies in 71 pediatric patients with SPIGFD treated for a mean duration of 3.9 years (274 subject-years of exposure). First-year height velocity increased from a baseline of 2.6 centimeters per year to 8.0 centimeters per year (p less than 0.0001), with sustained growth acceleration over 8 or more years of continuous treatment. The principal adverse event is hypoglycemia, reported in 42 percent of subjects; severe hypoglycemia requiring assistance occurred in 5 subjects, and hypoglycemic seizures or loss of consciousness occurred in 4 subjects. Hypoglycemia is mitigated by administration within 20 minutes of a meal or snack. Other notable adverse events include tonsillar and adenoidal hypertrophy (15 percent), injection site lipohypertrophy, and intracranial hypertension with papilledema (3 subjects). Long-term safety monitoring has not identified an increased incidence of malignancy at approved doses. Investigational applications of mecasermin extend to Rett syndrome (Phase 1, with improvement in apnea and neurobehavioral parameters), amyotrophic lateral sclerosis (negative in controlled trials), and various neuroprotective contexts supported by the neurotrophic properties of IGF-1.

    This monograph reviews the chemistry and recombinant production of mecasermin; the IGF-1R signaling pharmacology in molecular detail; the comprehensive pharmacokinetic record including binding protein dependence; the clinical evidence base across growth failure, neuroprotection, and metabolic indications; sourcing and quality verification for research-grade material; reconstitution and handling; stack-interaction considerations; adverse-event signal; and a comparative assessment of five alternative growth-promoting or IGF-1-axis compounds against mecasermin on five competency standards (novelty, effect size, promising potential, side-effect profile, and overall validation).

    Read the full monograph

    The full reference document covers compound identification, discovery and developmental history, mechanism of action, pharmacokinetics, sourcing and quality verification, and a curated reference list. Embedded inline below; download for offline reading.

    KDC-MN-1422Open in new tab →

    Download PDF →

    FOR RESEARCH USE ONLY. Not for medical, diagnostic, or therapeutic purposes. Not for human consumption. All information is provided for research and educational purposes only.

  • Teduglutide

    Dipeptidyl peptidase-IV-resistant glucagon-like peptide-2 analog and GLP-2 receptor agonist

    A recombinant 33-amino-acid analog of human glucagon-like peptide-2 bearing a single glycine-for-alanine substitution at position 2 that confers resistance to dipeptidyl peptidase-IV degradation, developed by NPS Pharmaceuticals and approved for the treatment of short bowel syndrome with intestinal failure in adults and pediatric patients dependent on parenteral support.

    Abstract

    Teduglutide is a recombinant analog of human glucagon-like peptide-2 (GLP-2) and the first GLP-2 receptor agonist approved for clinical use in the treatment of short bowel syndrome associated with intestinal failure (SBS-IF). The compound differs from native human GLP-2 by a single amino acid substitution: glycine replaces alanine at position 2 from the N-terminus, eliminating the dipeptidyl peptidase-IV (DPP-IV) cleavage site and extending the plasma elimination half-life from approximately 7 minutes (native GLP-2) to approximately 2 to 3 hours after subcutaneous administration [1, 2]. This modification preserves full agonist activity at the GLP-2 receptor (GLP-2R), a class B G-protein-coupled receptor expressed on intestinal subepithelial myofibroblasts, enteric neurons, and enteroendocrine cells, while enabling once-daily subcutaneous dosing at 0.05 mg/kg body weight.

    The intestinotrophic actions of teduglutide are mediated through GLP-2R activation on subepithelial myofibroblasts, which triggers downstream release of insulin-like growth factor-1 (IGF-1), epidermal growth factor (EGF), and keratinocyte growth factor (KGF) [3, 4]. These paracrine mediators drive crypt cell proliferation, inhibit enterocyte apoptosis, increase villus height, enhance mucosal barrier function, slow gastric emptying, reduce gastric acid secretion, and increase mesenteric blood flow [5]. The composite physiological effect is an expansion of absorptive intestinal surface area and an improvement in the efficiency of fluid and nutrient absorption in patients with shortened bowel.

    Clinical development centered on the pivotal Phase 3 STEPS trial (Study of Teduglutide Effectiveness in Parenteral Nutrition-Dependent Short-Bowel Syndrome Subjects), in which 86 adult SBS-IF patients were randomized to teduglutide 0.05 mg/kg/day or placebo for 24 weeks [6]. The primary endpoint (20 to 100 percent reduction in parenteral support volume at weeks 20 and 24) was met by 63 percent of teduglutide-treated patients compared to 30 percent of placebo-treated patients (P = 0.002). Three teduglutide-treated patients achieved complete enteral autonomy (full independence from parenteral support). Long-term extension studies (STEPS-2, STEPS-3) demonstrated sustained reductions in parenteral support requirements over 30 months or more, with additional patients achieving enteral autonomy on continued treatment [7, 8].

    Teduglutide received European Commission marketing authorization as Revestive in August 2012, United States Food and Drug Administration (FDA) approval as Gattex in December 2012 for adult SBS-IF patients dependent on parenteral support, and FDA pediatric indication expansion in May 2019 for patients one year of age and older [9, 10]. The compound was developed by NPS Pharmaceuticals (subsequently acquired by Shire, then Takeda), with Takeda holding global commercial rights.

    The principal safety concerns are the trophic effects of sustained GLP-2R stimulation on intestinal epithelium. Colorectal polyps have been reported in clinical trials and postmarketing surveillance at rates higher than placebo, necessitating colonoscopy within 6 months before treatment initiation, after 1 year of treatment, and every 5 years thereafter [11]. Intestinal obstruction, biliary and pancreatic disease, and fluid overload from increased intestinal absorption are additional monitored risks. Common adverse events at the approved dose include abdominal pain (28 percent), nausea (26 percent), injection site reactions (26 percent), abdominal distension (17 percent), and headache (16 percent) [12].

    This monograph reviews the chemistry, amino acid sequence, and DPP-IV resistance mechanism of teduglutide; the discovery of GLP-2 as an intestinotrophic factor and the development trajectory from preclinical demonstration through registration; the molecular pharmacology of GLP-2R signaling and downstream trophic mediators; the pharmacokinetic profile including absorption, distribution, metabolism, and elimination; the preclinical evidence in rodent models of SBS, mucositis, and colitis; the clinical evidence base across the STEPS trial series and pediatric studies; sourcing and quality verification considerations; reconstitution and handling; stack interaction considerations including effects on oral medication absorption; the adverse event and safety profile with emphasis on colorectal polyp risk; and a comparative assessment of five alternative GLP-2R agonists or intestinal trophic agents (glepaglutide, apraglutide, native GLP-2, growth hormone with glutamine, and somatropin) against teduglutide on five competency standards.

    Read the full monograph

    The full reference document covers compound identification, discovery and developmental history, mechanism of action, pharmacokinetics, sourcing and quality verification, and a curated reference list. Embedded inline below; download for offline reading.

    KDC-MN-1415Open in new tab →

    Download PDF →

    FOR RESEARCH USE ONLY. Not for medical, diagnostic, or therapeutic purposes. Not for human consumption. All information is provided for research and educational purposes only.

  • Dibucaine

    Plain-language summaryIntrigue 52 / 100

    Dibucaine (cinchocaine, Nupercaine) is a quinoline-based amide local anesthetic synthesized at Ciba in 1929. It is the most potent local anesthetic in the amide class on a milligram basis (roughly 15-fold the potency of lidocaine for infiltration), but the high potency comes paired with high systemic toxicity that restricts modern use to topical preparations like hemorrhoidal creams. The historical use in spinal anesthesia was extensive in the early-to-mid 20th century but has been displaced by safer agents. The compound has an interesting second life as a clinical laboratory test: the dibucaine number measures plasma butyrylcholinesterase activity through the relative inhibition of cholinesterase by dibucaine. Normal individuals show 80 percent inhibition; atypical heterozygotes 40 to 60 percent; atypical homozygotes 16 to 20 percent. The number predicts succinylcholine and mivacurium duration in patients with butyrylcholinesterase variants. Not stocked by Kodiac. This monograph is provided for research and educational reference.

    Intrigue 0–100 blends mechanism novelty, evidence strength, and translational potential. Kodiac editorial, not peer-reviewed.

    Amide local anesthetic (high-potency, topical)

    A quinoline-based amide local anesthetic with the highest potency in the class, used principally in topical preparations and as the historical reference for cholinesterase typing.

    Abstract

    Dibucaine (cinchocaine; 2-butoxy-N-[2-(diethylamino)ethyl]quinoline-4-carboxamide; CAS 85-79-0; molecular formula C20H29N3O2; molecular weight 343.46) is a quinoline-based amide local anesthetic synthesized by Karl Miescher at Ciba in 1929 (Nupercaine, Cinchocaine, Sovcaine). The compound is structurally distinct in carrying a quinoline ring and a butyloxy substituent rather than the dimethylphenyl ring of lidocaine and pipecoloxylidide-family agents. Dibucaine is the most potent local anesthetic in the amide class on a milligram basis (approximately 15-fold the potency of lidocaine for infiltration block), producing intense and prolonged sodium channel block; the high potency is paired with high systemic toxicity that restricts modern clinical use to topical preparations. The historical use in spinal anesthesia (Nupercaine spinal) was extensive in the early-to-mid 20th century but has been displaced by safer agents (bupivacaine, levobupivacaine, ropivacaine). Modern indications are topical: hemorrhoidal preparations (combined with hydrocortisone in commercial products), topical anesthesia of intact skin and mucous membranes, and ENT applications. Mechanism is the standard voltage-gated sodium channel block with state-dependent kinetics. The dibucaine number is a clinical laboratory parameter measuring plasma butyrylcholinesterase activity through the relative inhibition of cholinesterase by dibucaine: normal individuals show 80 percent inhibition, atypical heterozygotes 40 to 60 percent, atypical homozygotes 16 to 20 percent. The dibucaine number predicts succinylcholine and mivacurium duration in patients with butyrylcholinesterase variants and remains a clinically used diagnostic test.

    Read the full monograph

    The full reference document covers compound identification, discovery and developmental history, mechanism of action, pharmacokinetics, sourcing and quality verification, and a curated reference list. Embedded inline below; download for offline reading.

    KDC-MN-1318Open in new tab →

    Download PDF →

    FOR RESEARCH USE ONLY. Not for medical, diagnostic, or therapeutic purposes. Not for human consumption. All information is provided for research and educational purposes only.

  • NA-Semax Amidate

    N-acetylated and amidated Semax derivative

    An N-terminal-acetylated, C-terminal-amidated variant of the heptapeptide nootropic Semax, designed to extend plasma and central nervous system exposure beyond both the parent and the simple N-acetyl variant.

    Abstract

    NA-Semax Amidate (N-acetyl-Met-Glu-His-Phe-Pro-Gly-Pro-NH2) is a doubly modified variant of Semax (the seven-residue ACTH(4-10) analog Met-Glu-His-Phe-Pro-Gly-Pro) developed at the Russian Academy of Sciences as a long-acting analog. Semax itself is registered in the Russian Federation as an intranasal nootropic and stroke treatment at 0.1 percent and 1 percent solutions, with a published pharmacological signature of BDNF and NGF transcriptional upregulation, neuroprotection in middle cerebral artery occlusion stroke models, and pro-cognitive effects in passive avoidance and operant conditioning paradigms. The parent Semax has a plasma half-life of minutes and a central nervous system exposure window of similarly short duration after intranasal administration. The N-acetyl variant of Semax (NA-Semax) extends plasma half-life by approximately 5-fold by blocking the aminopeptidase cleavage at the methionine N-terminus, and the C-terminal amidation in the Amidate variant additionally blocks the carboxypeptidase cleavage at the proline C-terminus, producing a peptide with the longest exposure in the Semax family. Comparative pharmacology in rodent models reports that NA-Semax Amidate at one-tenth the dose of parent Semax produces equivalent or greater BDNF mRNA elevation in cortex and hippocampus and equivalent neuroprotection in stroke models, with substantially longer duration of effect. Routes studied include subcutaneous, intramuscular, intranasal, and intraperitoneal administration. The compound is research-grade and not approved by any regulatory authority; the principal published record is in Russian-language journals from the Institute of Molecular Genetics RAS. Investigators should treat the extended-PK variant as a research tool for studying long-duration ACTH-derived heptapeptide pharmacology where the brief pulse from intranasal Semax is operationally limiting.

    Read the full monograph

    The full reference document covers compound identification, discovery and developmental history, mechanism of action, pharmacokinetics, sourcing and quality verification, and a curated reference list. Embedded inline below; download for offline reading.

    KDC-MN-1334Open in new tab →

    Download PDF →

    FOR RESEARCH USE ONLY. Not for medical, diagnostic, or therapeutic purposes. Not for human consumption. All information is provided for research and educational purposes only.

  • Argireline (Acetyl Hexapeptide-8)

    SNAP-25 mimetic hexapeptide topical neuromuscular cosmetic peptide

    A six-residue acetylated peptide modeled on the N-terminal SNAP-25 sequence cleaved by botulinum neurotoxin, used in topical cosmetic formulations for expression-line reduction.

    Abstract

    Argireline (Acetyl hexapeptide-8; Ac-Glu-Glu-Met-Gln-Arg-Arg-NH2; CAS 616204-22-9 or 575826-37-6 acetate; molecular weight 888.97 free peptide) is a six-residue N-acetylated, C-amidated peptide developed by the Spanish company Lipotec (now part of Lubrizol) and marketed as Argireline since 2002. The peptide sequence corresponds to the N-terminus of SNAP-25, a key SNARE complex protein that mediates synaptic vesicle fusion at the neuromuscular junction; SNAP-25 is the substrate cleaved by botulinum neurotoxin type A (Botox) at the same N-terminal region. The pharmacological argument for Argireline as a topical cosmetic ingredient is that the peptide competes with endogenous SNAP-25 for assembly into the SNARE complex, weakening neurotransmitter release at the neuromuscular junction at the application site and reducing the muscular contraction that drives expression-line formation. The mechanism is qualitatively similar to botulinum toxin but operates at substantially lower potency and through a distinct molecular mechanism (competitive SNAP-25 mimicry rather than enzymatic cleavage of endogenous SNAP-25). Topical penetration of an intact polar hexapeptide through the stratum corneum is intrinsically poor; modern Argireline formulations use liposomal encapsulation or other delivery vehicles to improve penetration. Published clinical evidence is mixed and dominated by manufacturer-sponsored studies; independent academic studies report modest reduction in expression-line depth at 30 days of twice-daily 10 percent topical application, substantially less than the effect of intramuscular botulinum toxin. The compound is sold as a cosmetic ingredient (not a regulated drug) in essentially all major cosmetic markets including the United States, EU, and East Asia. Stability of formulated solutions is moderate; solid peptide stored at refrigerated conditions has multi-year shelf life.

    Read the full monograph

    The full reference document covers compound identification, discovery and developmental history, mechanism of action, pharmacokinetics, sourcing and quality verification, and a curated reference list. Embedded inline below; download for offline reading.

    KDC-MN-1349Open in new tab →

    Download PDF →

    FOR RESEARCH USE ONLY. Not for medical, diagnostic, or therapeutic purposes. Not for human consumption. All information is provided for research and educational purposes only.

  • Buserelin

    Synthetic gonadotropin-releasing hormone superagonist nonapeptide with paradoxical chronic suppression of pituitary-gonadal axis through GnRH receptor desensitization and downregulation

    A synthetic nonapeptide analog of endogenous gonadotropin-releasing hormone bearing a D-serine(tert-butyl) substitution at position 6 and an ethylamide C-terminal modification, conferring 20- to 170-fold greater potency than native GnRH and resistance to enzymatic degradation, developed at Hoechst AG in the mid-1970s as one of the first clinically viable GnRH superagonists and now registered in approximately 40 jurisdictions for hormone-dependent prostate cancer, endometriosis, uterine fibroids, premenopausal breast cancer, central precocious puberty, and pituitary downregulation in assisted reproduction protocols.

    Abstract

    Buserelin ([D-Ser(tBu)6,des-Gly-NH2-10]GnRH ethylamide; CAS 57982-77-1, free base; 68630-75-1, acetate salt) is a synthetic nonapeptide analog of the hypothalamic decapeptide gonadotropin-releasing hormone (GnRH, also designated luteinizing hormone-releasing hormone, LHRH) first described by Sandow and colleagues at Hoechst AG in 1976 and approved for clinical use in 1984 [1, 2]. The compound incorporates two structural modifications to native GnRH that collectively confer superagonist potency and metabolic stability: replacement of glycine at position 6 with D-serine bearing a tert-butyl ether on the side-chain hydroxyl, which eliminates the principal endopeptidase cleavage site and introduces conformational rigidity favorable to receptor binding; and replacement of the C-terminal glycinamide (position 10) with an ethylamide, which further resists carboxypeptidase degradation. The resulting peptide binds the type I GnRH receptor with affinity approximately 20- to 170-fold greater than native GnRH and produces a biphasic pharmacological response that is the mechanistic foundation for all clinical applications [3, 4]. Acute administration stimulates pituitary gonadotroph secretion of luteinizing hormone and follicle-stimulating hormone, producing transient elevations in gonadal steroid output (the “flare” phase, lasting 7 to 14 days). Chronic continuous administration produces homologous desensitization of the GnRH receptor through receptor internalization, uncoupling from Gq/11-phospholipase C signaling, and transcriptional downregulation of GnRH receptor expression, resulting in profound and sustained suppression of gonadotropin secretion and a hypogonadal state equivalent to surgical castration in both sexes [5, 6]. This medical castration is reversible on cessation of treatment. Buserelin was the first GnRH agonist demonstrated to achieve medical castration in humans via intranasal administration, an observation reported by Sandow and colleagues in 1980 that established the clinical viability of non-injectable GnRH agonist therapy [2]. The compound is registered in approximately 40 jurisdictions across Europe, the United Kingdom, Canada, New Zealand, South Africa, Latin America, and Asia, but is not approved in the United States or Australia. Registered indications include hormone-responsive prostate cancer, endometriosis, uterine fibroids, premenopausal breast cancer, and pituitary downregulation as an adjunct to controlled ovarian hyperstimulation in assisted reproduction [7, 8, 9]. The compound is additionally used off-label for central precocious puberty and as a component of gender-affirming hormone therapy. Pharmacokinetics are characterized by negligible oral bioavailability due to gastrointestinal peptidase degradation, approximately 2.5 to 3.3 percent intranasal bioavailability, and approximately 70 percent subcutaneous bioavailability [10]. The plasma elimination half-life is 50 to 80 minutes after intravenous or subcutaneous administration and approximately 1 to 2 hours after intranasal dosing. Protein binding is low (approximately 15 percent). Metabolism occurs principally through pyroglutamyl peptidase and chymotrypsin-like endopeptidase activity in the liver, kidneys, and gastrointestinal tract, with approximately 50 percent of the administered dose recovered unchanged in urine [10, 11]. Formulations include aqueous solution for subcutaneous injection and intranasal spray (requiring multiple daily administrations) and sustained-release subcutaneous implants providing 2- or 3-month depot delivery. The adverse-event profile is dominated by the pharmacological consequences of gonadal steroid suppression: hot flashes, reduced libido, erectile dysfunction or vaginal dryness, and long-term bone mineral density reduction. The initial flare phase carries specific risk in metastatic prostate cancer (bone pain exacerbation, spinal cord compression, ureteral obstruction), which is mitigated clinically by co-administration of an antiandrogen during the first 2 to 4 weeks of therapy. This monograph reviews the chemistry and synthesis, the biphasic GnRH receptor pharmacology, the comprehensive human pharmacokinetic record, the clinical evidence base across prostate cancer, endometriosis, uterine fibroids, breast cancer, precocious puberty, and assisted reproduction indications, sourcing and quality verification, reconstitution and handling, stack interactions, adverse-event signal, and a comparative assessment of five GnRH agonist candidates against buserelin on five competency standards.

    Read the full monograph

    The full reference document covers compound identification, discovery and developmental history, mechanism of action, pharmacokinetics, sourcing and quality verification, and a curated reference list. Embedded inline below; download for offline reading.

    KDC-MN-1395Open in new tab →

    Download PDF →

    FOR RESEARCH USE ONLY. Not for medical, diagnostic, or therapeutic purposes. Not for human consumption. All information is provided for research and educational purposes only.

  • Elabela

    Endogenous peptide hormone and apelin receptor (APJ/APLNR) agonist of the apelinergic signaling system

    A 32-amino-acid secreted peptide hormone discovered in 2013 as the second endogenous ligand of the apelin receptor (APJ/APLNR), essential for vertebrate cardiovascular morphogenesis, human embryonic stem cell self-renewal, placental angiogenesis, and renal fluid homeostasis, with preclinical cardioprotective, renoprotective, antihypertensive, and neuroprotective activity across multiple disease models.

    Abstract

    Elabela (ELA), also designated Apela, Toddler, and Ende, is a secreted peptide hormone encoded by the APELA gene on human chromosome 4q32.3. The gene encodes a 54-amino-acid preproprotein containing a 22-residue signal peptide; cleavage yields the 32-amino-acid mature peptide ELA-32 (sequence QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP), which may be further processed by proprotein convertases to generate the bioactive isoforms ELA-21 and ELA-11 [1, 2]. Elabela was discovered independently by two groups in 2013 and 2014: Chng et al. (2013) identified the peptide in zebrafish as a hormone essential for heart development signaling through the apelin receptor (APLNR/APJ), while Pauli et al. (2014) characterized the same molecule as “Toddler,” an embryonic signal promoting mesodermal cell migration [1, 3]. The peptide is the second endogenous ligand of the apelin receptor, a class A G-protein-coupled receptor previously known to bind only apelin; despite sharing a common receptor, Elabela and apelin exhibit less than 25 percent sequence similarity and display distinct spatiotemporal expression profiles and partially divergent signaling bias [4, 5]. Elabela activates the apelin receptor through Gi/o-coupled inhibition of adenylyl cyclase, stimulation of ERK1/2 and PI3K/AKT/mTOR pathways, mobilization of intracellular calcium, and recruitment of beta-arrestin, functioning as a balanced agonist across G-protein-dependent and beta-arrestin-dependent pathways [5, 6]. The binding affinity of ELA-32 for the human apelin receptor is high, with reported IC50 values of approximately 0.27 nanomolar and Kd values of approximately 0.51 nanomolar [7]. Physiologically, Elabela is expressed at high levels during embryogenesis across vertebrate species and in adult tissues with restricted distribution, principally kidney (collecting ducts and loops of Henle), prostate, and vascular endothelium [2, 8]. The peptide is essential for vertebrate cardiovascular development: genetic ablation of Elabela in zebrafish produces severe cardiac malformations including rudimentary or absent hearts, phenocopying loss of the apelin receptor itself [1]. In mice, Elabela knockout produces preeclampsia-like symptoms during pregnancy including proteinuria, hypertension, defective placental angiogenesis, and reduced fetal weight, effects that are rescued by exogenous ELA infusion [9]. A separate demonstration by Ho et al. (2015) established that Elabela is an endogenous growth factor sustaining human embryonic stem cell self-renewal via the PI3K/AKT pathway, with CRISPR-mediated deletion causing loss of pluripotency and cell death [10]. In the adult cardiovascular system, Elabela functions as an endogenous agonist of the apelin receptor producing positive inotropy, vasodilation, increased cardiac output, and depressor responses comparable to apelin; expression is downregulated in pulmonary arterial hypertension, and exogenous administration attenuates right ventricular hypertrophy and pulmonary vascular remodeling in monocrotaline-exposed rats [11]. Preclinical cardioprotective activity has been demonstrated across myocardial infarction, ischemia-reperfusion injury, and hypertensive cardiac fibrosis models, operating through PI3K/AKT-mediated anti-apoptotic, anti-fibrotic, and pro-angiogenic mechanisms [12, 13, 14]. Renoprotective activity is characterized by antagonism of the intrarenal renin-angiotensin system, reduction of blood pressure and albuminuria in salt-sensitive hypertensive rats, and prevention of vasopressin-induced aquaporin-2 translocation in collecting duct principal cells, thereby promoting aqueous diuresis [15, 16]. Neuroprotective activity has been demonstrated in rodent models of ischemic stroke, where ELA attenuates neuronal apoptosis, ferroptosis, and pyroptosis through APJ-dependent signaling cascades [17, 18]. The in vitro plasma half-life of ELA-32 in human plasma is approximately 47 minutes, substantially longer than that of apelin-13 (approximately 5 minutes in vivo), though rapid degradation occurs in kidney homogenates (half-life approximately 44 seconds), and the short systemic half-life has motivated the development of Fc-fusion, PEGylated, and acylated analogs with extended duration of action [19, 20, 21]. No human clinical trials of exogenous Elabela administration have been completed as of the monograph revision date; the compound remains in the preclinical-to-translational research phase. This monograph reviews the chemistry, isoform biology, and synthesis of Elabela; the receptor pharmacology and signaling mechanisms in molecular detail; the pharmacokinetic profile including metabolism and stability-enhancement strategies; the preclinical evidence base across cardiovascular, renal, obstetric, stem cell, neurological, and oncological applications; sourcing and quality verification for research-grade material; reconstitution and handling; stack-interaction considerations; the adverse-event and safety signal from animal studies; and a comparative assessment of five apelinergic system candidates against Elabela on five competency standards.

    Read the full monograph

    The full reference document covers compound identification, discovery and developmental history, mechanism of action, pharmacokinetics, sourcing and quality verification, and a curated reference list. Embedded inline below; download for offline reading.

    KDC-MN-1385Open in new tab →

    Download PDF →

    FOR RESEARCH USE ONLY. Not for medical, diagnostic, or therapeutic purposes. Not for human consumption. All information is provided for research and educational purposes only.

  • Sevoflurane

    Plain-language summaryIntrigue 65 / 100

    Sevoflurane is the inhalational anesthetic of choice for pediatric mask induction, owing to its non-pungent character and pleasant odor that allow children to breathe down to anesthesia without IV access first. Synthesized by Ross Terrell at Travenol in 1968, brought to clinical use in Japan in 1990, FDA-approved in 1995 (Ultane). Blood-gas partition coefficient of 0.65 gives faster kinetics than isoflurane and a favorable cardiovascular profile with preserved cardiac output. Mechanism mirrors other halogenated ethers: GABA-A potentiation, K2P channel activation, glycine and NMDA modulation. The classical concern is Compound A, a degradation product formed when sevoflurane reacts with CO2 absorbents at very low fresh gas flows; nephrotoxic in rats but not demonstrated in humans within recommended flow limits. Workhorse modern volatile. Not stocked by Kodiac. This monograph is provided for research and educational reference.

    Intrigue 0–100 blends mechanism novelty, evidence strength, and translational potential. Kodiac editorial, not peer-reviewed.

    Halogenated ether volatile general anesthetic

    A non-pungent fluorinated methyl isopropyl ether with a low blood-gas coefficient enabling fast induction and the dominant inhalational agent for pediatric mask induction.

    Abstract

    Sevoflurane (fluoromethyl 2,2,2-trifluoro-1-(trifluoromethyl)ethyl ether; CAS 28523-86-6; molecular formula C4H3F7O; molecular weight 200.05) is a fluorinated methyl isopropyl ether volatile anesthetic synthesized by Ross Terrell at Travenol Laboratories in 1968, brought to clinical use in Japan in 1990, and approved by the FDA in 1995 (Ultane, Sojourn). The minimum alveolar concentration (MAC) at age 40 is 1.8 percent in oxygen; the blood-gas partition coefficient is 0.65, faster than isoflurane (1.4) but slower than desflurane (0.42). The non-pungent character and absence of airway irritation make sevoflurane the agent of choice for inhalational induction of anesthesia, particularly in pediatric patients where intravenous access is established after induction. Mechanism parallels other halogenated ethers (GABA-A positive allosteric modulation, K2P channel activation, glycine and NMDA effects); the agent is achiral. Hepatic metabolism via CYP2E1 produces hexafluoroisopropanol and inorganic fluoride; the fluoride concentrations approach the historical nephrotoxic threshold associated with methoxyflurane (50 micromolar plasma) during prolonged exposure but published clinical data have not demonstrated nephrotoxicity in humans even with extended cases, attributed to the absence of intrarenal defluorination. The principal residual concern is degradation of sevoflurane in carbon dioxide absorbents (soda lime, Baralyme) at low fresh gas flows producing Compound A, which is nephrotoxic in rats but lacks demonstrated human renal injury within recommended fresh gas flow limits (1 to 2 L/min). Cardiovascular profile is favorable with preserved cardiac output, modest reduction in systemic vascular resistance, and minimal coronary steal physiology.

    Read the full monograph

    The full reference document covers compound identification, discovery and developmental history, mechanism of action, pharmacokinetics, sourcing and quality verification, and a curated reference list. Embedded inline below; download for offline reading.

    KDC-MN-1302Open in new tab →

    Download PDF →

    FOR RESEARCH USE ONLY. Not for medical, diagnostic, or therapeutic purposes. Not for human consumption. All information is provided for research and educational purposes only.

  • Benzocaine

    Plain-language summaryIntrigue 42 / 100

    Benzocaine is the simplest ester local anesthetic, structurally just ethyl 4-aminobenzoate without the diethylamino-ethanol group of procaine. The simpler structure makes it lipophilic and poorly water-soluble, useful only for topical mucous membrane anesthesia. You know it as the active ingredient in Cepacol throat lozenges, Anbesol and Orajel oral gels, hemorrhoidal preparations, and topical ENT and bronchoscopy sprays. Onset is rapid (15 to 60 seconds on mucous membranes); duration is 5 to 15 minutes. The main safety concern is dose-dependent methemoglobinemia, more pronounced than with prilocaine, that has driven FDA boxed warnings against benzocaine spray and gel use in infants. The mechanism is hepatic conversion to nitroso and N-hydroxy metabolites that oxidize hemoglobin. The FDA advised against benzocaine teething gels in infants under two years in 2018. Not stocked by Kodiac. This monograph is provided for research and educational reference.

    Intrigue 0–100 blends mechanism novelty, evidence strength, and translational potential. Kodiac editorial, not peer-reviewed.

    Ester local anesthetic (topical only)

    The simplest ester local anesthetic, used as a topical mucous membrane anesthetic and the principal ingredient in over-the-counter sore-throat lozenges.

    Abstract

    Benzocaine (ethyl 4-aminobenzoate; CAS 94-09-7; molecular formula C9H11NO2; molecular weight 165.19) is an ester-class local anesthetic, structurally the simplest member of the para-aminobenzoate family (the primary aminobenzoate ester directly esterified to ethanol, lacking the diethylamino-ethanol group of procaine). The simpler structure produces a lipophilic, water-poorly-soluble compound suitable only for topical mucous membrane anesthesia; the absence of the tertiary amine restricts utility for infiltration and regional anesthesia. Benzocaine is the principal active ingredient in over-the-counter throat lozenges (Cepacol), oral analgesic gels (Anbesol, Orajel), topical preparations for hemorrhoidal and minor wound use, and topical ENT and bronchoscopy preparation. Mechanism is voltage-gated sodium channel block in surface nerve fibers contacted topically. Onset is rapid (15 to 60 seconds on mucous membranes); duration is 5 to 15 minutes. The principal safety concern is dose-dependent methemoglobinemia, more pronounced than with prilocaine, that has driven FDA boxed warnings against benzocaine spray and gel use in infants and limited topical doses in children and adults. The mechanism is hepatic conversion of benzocaine to nitroso and N-hydroxy metabolites that oxidize hemoglobin iron to the ferric state. Clinical methemoglobinemia is reported with topical mucosal application of as little as 250 mg in vulnerable individuals; the risk is amplified in G6PD deficiency, infancy (low NADH-methemoglobin reductase activity), and concurrent oxidant drug exposure. Methylene blue is the rescue therapy. The FDA advised in 2018 against benzocaine teething gels in infants under 2 years.

    Read the full monograph

    The full reference document covers compound identification, discovery and developmental history, mechanism of action, pharmacokinetics, sourcing and quality verification, and a curated reference list. Embedded inline below; download for offline reading.

    KDC-MN-1317Open in new tab →

    Download PDF →

    FOR RESEARCH USE ONLY. Not for medical, diagnostic, or therapeutic purposes. Not for human consumption. All information is provided for research and educational purposes only.

  • NA-Selank

    N-acetylated Selank derivatives with extended pharmacokinetics

    N-terminal-acetylated and amidated variants of the heptapeptide anxiolytic Selank, designed to extend plasma and central nervous system exposure beyond the parent peptide.

    Abstract

    NA-Selank (N-acetyl-Thr-Lys-Pro-Arg-Pro-Gly-Pro) and NA-Selank Amidate (the same N-acetylated heptapeptide with C-terminal amidation, Pro-NH2) are N-terminal-modified derivatives of Selank, the seven-residue peptide anxiolytic developed at the Russian Academy of Sciences as an analog of the endogenous tetrapeptide tuftsin (Thr-Lys-Pro-Arg). The parent Selank is registered as a medicine in the Russian Federation as an intranasal anxiolytic at 0.15 percent solution; the principal pharmacological signature is anxiolysis without sedation, modest pro-cognitive activity, and immunomodulation through tuftsin-receptor binding on monocytes and natural killer cells. Selank itself has a short plasma half-life of minutes and is administered intranasally to leverage direct olfactory and trigeminal transport to the central nervous system; the N-acetyl modification at the threonine N-terminus blocks the principal aminopeptidase cleavage site and extends plasma half-life by approximately 5-fold, while the C-terminal amidation in the Amidate variant similarly blocks carboxypeptidase cleavage at the proline C-terminus. The combined modifications produce a heptapeptide with substantially extended exposure suitable for parenteral administration with central nervous system effect. Mechanism includes BDNF transcriptional upregulation, GABAergic and serotonergic modulation, and tuftsin-receptor immunomodulation. Both NA-Selank and NA-Selank Amidate are research-grade peptides without regulatory approval; published characterization is principally in Russian-language journals and is dominated by the originating Institute of Molecular Genetics RAS research group. Investigators should treat the extended-PK variants as research tools for studying parenteral Selank pharmacology and should consider that the immune-modulatory profile may be more pronounced with extended exposure than with the brief intranasal pulse achieved by the parent.

    Read the full monograph

    The full reference document covers compound identification, discovery and developmental history, mechanism of action, pharmacokinetics, sourcing and quality verification, and a curated reference list. Embedded inline below; download for offline reading.

    KDC-MN-1333Open in new tab →

    Download PDF →

    FOR RESEARCH USE ONLY. Not for medical, diagnostic, or therapeutic purposes. Not for human consumption. All information is provided for research and educational purposes only.