Skip to content

Shop
Scholar
Lab Results
Learn
Vote
Forum
About

Search Kodiac

Sign in Sign up Account

Author: kodiac

Ecnoglutide

Our opinion on this compoundNovel, promising

70/100

First cAMP-biased GLP-1RA with strong Phase 3 data and a genuinely novel receptor pharmacology story

Yeah, we’re interested in this one. Ecnoglutide is doing something the rest of the GLP-1 field hasn’t actually done yet: it was engineered from the ground up to be a biased agonist, not just a longer-acting peptide with a fancier linker. The Guo et al. (2023) characterization in XW003 is serious receptor pharmacology work. The key numbers are striking: full Gs/cAMP potency (EC50 0.018 nM, comparable to semaglutide), beta-arrestin Emax capped at roughly 54 to 60 percent of semaglutide, and receptor internalization EC50 pushed past 10 micromolar versus 0.093 micromolar for sema. That’s not a marginal difference. That’s a compound that essentially stays on the surface.

The mechanism rationale matters here. Beta-arrestin recruitment at GLP-1R is the canonical driver of receptor endocytosis and the tachyphylaxis observed with sustained agonist exposure. If you can preserve Gs/cAMP signaling while blunting the internalization arm, the theoretical outcome is a receptor that doesnt disappear from the cell surface under chronic dosing. Whether this translates clinically into meaningfully better efficacy per receptor occupancy or genuinely reduced GI burden is the open question. The Phase 3 SLIMMER data are real: 15.4 percent mean weight loss at 2.4 mg over 48 weeks, 92.8 percent of participants hitting 5 percent or greater. Those numbers are competitive with semaglutide in comparable populations. They’re not tirzepatide numbers, but thats a different mechanism class.

Here’s what we like about the evidence package: three Phase 3 trials, a genuine active comparator arm (EECOH-2 vs dulaglutide, 52 weeks), and NMPA approval in January 2026. For a compound that hasn’t touched FDA or EMA review yet, thats an unusual depth of controlled data. The HbA1c reductions in EECOH-1 are clinically meaningful, and the Phase 2 glycemic data are internally consistent with the Phase 3 readouts. The Ala8Val substitution also resolves the alpha-aminoisobutyric acid manufacturing issue that complicates semaglutide synthesis, which is a non-trivial advantage for research-grade sourcing and scale.

What holds ecnoglutide back from a higher placement is straightforward. It’s still one developer, one regulatory jurisdiction, no FDA or EMA file, and no head-to-head data showing that the biased pharmacology advantage is clinically detectable in a powered trial. The GLP-1 space is mature and crowded; tirzepatide and retatrutide are clearer bets on differentiated efficacy. Ecnoglutide’s real value for an investigator is precisely the biased-agonism probe utility: if you want to dissect which downstream effects at GLP-1R are Gs-driven versus beta-arrestin-driven in vivo, this is the compound you reach for. That’s genuine bench value. It’s just not category-defining on its own.

Novelty

70

Mechanism promise

78

In-category differentiation

60

Evidence quality

72

Translational signal

75

Research bench value

68

Rationale Ecnoglutide earns its score on the strength of a real mechanistic differentiator (cAMP-biased agonism with near-absent receptor internalization) and an unusual depth of Phase 3 evidence for a compound that only reached NMPA approval in January 2026; it falls short of the 80s because it occupies a well-funded GLP-1 space dominated by tirzepatide and retatrutide, its evidence base is single-developer and single-regulator, and the biased-agonism advantage over semaglutide has not yet been tested in a head-to-head clinical powered for differential tolerability.

Editorial commentary from Kodiac biolabs. Not a recommendation, not clinical advice. Research use only.

cAMP-biased glucagon-like peptide-1 receptor agonist with preferential Gs/cAMP signaling over beta-arrestin recruitment

A long-acting, fatty acid-conjugated GLP-1 analog developed at Sciwind Biosciences as the first cAMP signaling-biased GLP-1 receptor agonist, distinguished from semaglutide and other marketed incretin mimetics by selective activation of the Gs/adenylyl cyclase/cAMP cascade with markedly reduced beta-arrestin recruitment and GLP-1 receptor internalization, yielding sustained receptor surface availability and enhanced glycemic and weight-reducing efficacy in clinical populations.

Abstract

Ecnoglutide (XW003; CAS 2459531-73-6; molecular formula C194H304N48O61; molecular weight 4284.84 g/mol) is a lipopeptide analog of human glucagon-like peptide-1 (GLP-1) (7-37) engineered with an alanine-to-valine substitution at position 8 and a C18 fatty diacid conjugated to the epsilon-amino group of lysine 30 through a gamma-glutamate and dual 2-(2-(2-aminoethoxy)ethoxy)acetic acid linker. Designed and developed at Sciwind Biosciences (Hangzhou, China), ecnoglutide is the first GLP-1 receptor agonist intentionally optimized for cAMP signaling bias: it activates the Gs/adenylyl cyclase/cAMP cascade with an EC50 of 0.018 nM (comparable to semaglutide at 0.012 nM) while producing substantially reduced beta-arrestin recruitment (Emax approximately 54 to 60 percent of semaglutide, EC50 approximately 1300 nM) and negligible GLP-1 receptor internalization (EC50 greater than 10 micromolar versus 0.093 micromolar for semaglutide) [1]. The biased signaling profile preserves receptor surface density and downstream insulin secretion while reducing the desensitization, tachyphylaxis, and gastrointestinal adverse events theoretically attributable to beta-arrestin-mediated receptor endocytosis. In surface plasmon resonance binding studies, ecnoglutide demonstrates a dissociation constant (KD) of 1.45 nanomolar at the human GLP-1 receptor, approximately 10- to 30-fold higher affinity than semaglutide (KD 17.0 nanomolar) [1]. The compound consists exclusively of natural amino acids, simplifying the manufacturing process relative to semaglutide (which incorporates alpha-aminoisobutyric acid at position 8). Pharmacokinetics in healthy human volunteers support once-weekly subcutaneous dosing: the terminal elimination half-life at steady state ranges from 124 to 138 hours, with median time to peak concentration (Tmax) of 12 to 72 hours and dose-proportional plasma exposure across the studied dose range [1]. In the Phase 2 randomized, double-blind, placebo-controlled trial in 145 adults with type 2 diabetes, ecnoglutide at 0.4, 0.8, and 1.2 mg weekly for 20 weeks produced HbA1c reductions of 1.81, 1.90, and 2.39 percentage points, respectively, versus 0.55 points on placebo [2]. In the Phase 3 EECOH-1 trial of ecnoglutide monotherapy (0.6 mg and 1.2 mg weekly) in 211 patients with type 2 diabetes, up to 76.1 percent of patients in the 1.2 mg cohort achieved HbA1c targets of 6.5 percent or less [3]. In the Phase 3 EECOH-2 active-comparator trial, ecnoglutide 0.6 mg and 1.2 mg weekly demonstrated non-inferiority to dulaglutide 1.5 mg weekly on HbA1c reduction over 52 weeks, with the 1.2 mg dose achieving statistically significantly greater reduction [4]. In the Phase 3 SLIMMER trial in 664 adults with overweight or obesity without diabetes, ecnoglutide at 1.2, 1.8, and 2.4 mg weekly produced mean body weight reductions of 9.1, 10.9, and 13.2 percent, respectively, at 40 weeks versus 0.1 percent on placebo; at 48 weeks, the 2.4 mg dose achieved 15.4 percent mean weight loss, with 92.8 percent of participants achieving 5 percent or greater weight loss [5]. The safety profile is consistent with the GLP-1 receptor agonist class: the principal adverse events are gastrointestinal (nausea, diarrhea, decreased appetite), predominantly mild to moderate in severity, concentrated during the dose-escalation period, and diminishing over time. Hypoglycemia risk is low. China’s National Medical Products Administration (NMPA) approved ecnoglutide injection for chronic weight management in January 2026, making it the first approved cAMP-biased GLP-1 receptor agonist worldwide [6]. The compound is not approved by the United States Food and Drug Administration or by the European Medicines Agency as of the most recent monograph revision. This monograph reviews the chemistry, biased-agonist pharmacology, comprehensive pharmacokinetics, the clinical evidence base across type 2 diabetes and obesity indications, sourcing and quality considerations, reconstitution and handling, stack-interaction implications, adverse-event signal, and a comparative assessment of five GLP-1 receptor agonist and incretin mimetic candidates against ecnoglutide on five competency standards.

Read the full monograph

The full reference document covers compound identification, discovery and developmental history, mechanism of action, pharmacokinetics, sourcing and quality verification, and a curated reference list. Embedded inline below; download for offline reading.

KDC-MN-1411Open in new tab →

Download PDF →

FOR RESEARCH USE ONLY. Not for medical, diagnostic, or therapeutic purposes. Not for human consumption. All information is provided for research and educational purposes only.

May 10, 2026
Histrelin

Our opinion on this compoundEstablished workhorse

45/100

Mature GnRH superagonist with highest class binding affinity but solved biology and limited frontier research value

Look, histrelin sits in an interesting position: genuinely best-in-class on two metrics that matter (receptor binding affinity and dosing interval), but competing in a pharmacological space the bench research community largely moved past in the 1990s. The compound was developed at Ortho Pharmaceutical in the early 1980s, and while the once-yearly hydrogel implant reformulation was a real delivery-system innovation when Supprelin LA and Vantas launched, the underlying GnRH receptor pharmacology is textbook material at this point. The biphasic agonist-then-suppression mechanism is elegant. The Gq/11-PLC uncoupling, receptor internalization, and transcriptional downregulation of GnRH receptor expression are well-characterized. Thats not a knock on the compound; it just means theres not much left to discover there for most investigators.

What makes histrelin worth benchmarking against leuprolide, goserelin, and the rest is the D-His(Bzl) substitution at position 6, which eliminates the principal endopeptidase cleavage site and introduces hydrophobic receptor contacts that push binding affinity to 100- to 200-fold above native GnRH, the highest in the clinical class. In research settings where you need reliable, sustained HPG axis suppression with a single administration, that affinity profile is genuinely useful. But most bench investigators reach for leuprolide or degarelix first because sourcing is more predictable and the literature is considerably denser.

The evidence quality is real. Two FDA approvals, multiple phase 2/3 trials, a clean pediatric pharmacokinetic dataset in the CPP population, steady-state implant concentrations well-characterized at 0.2 to 0.4 ng/mL. The translational signal is unambiguous: medical castration is achieved reliably, and the CPP data are as clean as clinical endocrinology gets. We’re not questioning efficacy.

What we’re questioning is whether this is a frontier research target. Honestly, it isn’t. The action in the GnRH space right now is in the antagonists, particularly relugolix (oral, no flare, rapidly reversible, cardiovascular signal in phase 3), which is generating genuinely new clinical questions and eating into the agonist market. The agonist mechanism, including histrelin’s version of it, is solved biology for most investigators. If you’re building an HPG axis suppression model, histrelin works. If you’re studying GnRH receptor pharmacology and need a high-affinity probe, its binding characteristics give it niche utility. But it’s not where serious endocrinology or reproductive biology researchers are pointing their attention.

Vantas was discontinued in 2020 for manufacturing reasons, which narrows the compound’s clinical footprint to the CPP indication. Supprelin LA remains available, but CPP research generates modest interest compared to the metabolic and oncology frontiers. What you’re left with is a well-validated, high-affinity GnRH superagonist with a distinguished clinical record, a genuinely distinctive delivery system, and limited bench-level novelty. Worth having in a reference library; not the compound an investigator should build a program around today.

Novelty

20

Mechanism promise

32

In-category differentiation

52

Evidence quality

68

Translational signal

72

Research bench value

28

Rationale Histrelin earns real credit for its position-6 D-His(Bzl) substitution and 100- to 200-fold potency advantage, plus a genuinely distinctive once-yearly implant delivery system, but the GnRH receptor desensitization mechanism is textbook-level understood and the research frontier has clearly moved to antagonists. Evidence quality and translational signal are strong (two FDA approvals, clean PK record), but novelty and bench probe value are low for most investigators.

Editorial commentary from Kodiac biolabs. Not a recommendation, not clinical advice. Research use only.

Synthetic gonadotropin-releasing hormone superagonist nonapeptide with sustained pituitary-gonadal axis suppression through GnRH receptor desensitization and downregulation

A synthetic nonapeptide analog of endogenous gonadotropin-releasing hormone bearing a D-histidine(N-benzyl) substitution at position 6 and an ethylamide C-terminal modification, conferring approximately 100- to 200-fold greater potency than native GnRH and marked resistance to enzymatic degradation, developed at Ortho Pharmaceutical in the early 1980s and now FDA-approved as a once-yearly subcutaneous hydrogel implant for advanced prostate cancer (Vantas, approved 2004, discontinued 2020) and central precocious puberty (Supprelin LA, approved 2007), distinguished from other GnRH agonists by the highest binding affinity in the clinical class and the longest approved dosing interval achieved through a diffusion-controlled hydrogel polymer reservoir delivery system.

Abstract

Histrelin (pGlu-His-Trp-Ser-Tyr-D-His(Bzl)-Leu-Arg-Pro-NHEt; CAS 76712-82-8, free base; molecular formula C66H86N18O12; molecular weight 1323.53) is a synthetic nonapeptide analog of the hypothalamic decapeptide gonadotropin-releasing hormone (GnRH, also designated luteinizing hormone-releasing hormone, LHRH) distinguished from other members of the clinical GnRH agonist class by exceptionally high receptor binding affinity and by a unique formulation as a once-yearly subcutaneous hydrogel polymer implant [1, 2]. The compound incorporates two structural modifications to native GnRH that collectively confer superagonist potency and metabolic stability: replacement of glycine at position 6 with D-histidine bearing an N-benzyl substituent on the imidazole ring, which eliminates the principal endopeptidase cleavage site and introduces a bulky aromatic moiety favorable to hydrophobic interaction with the GnRH receptor transmembrane domain; and replacement of the C-terminal glycinamide (position 10) with an ethylamide, which further resists carboxypeptidase degradation [3, 4]. The resulting peptide binds the type I GnRH receptor with affinity approximately 100- to 200-fold greater than native GnRH and produces the characteristic biphasic pharmacological response common to all GnRH superagonists [5, 6]. Acute administration stimulates pituitary gonadotroph secretion of luteinizing hormone and follicle-stimulating hormone, producing transient elevations in gonadal steroid output (the “flare” phase, lasting 7 to 14 days). Chronic continuous administration produces homologous desensitization of the GnRH receptor through receptor internalization, uncoupling from Gq/11-phospholipase C signaling, and transcriptional downregulation of GnRH receptor expression, resulting in profound and sustained suppression of gonadotropin secretion and a hypogonadal state equivalent to surgical castration in both sexes [5, 6, 7]. Histrelin was initially developed at Ortho Pharmaceutical Corporation (a Johnson and Johnson subsidiary) in the early 1980s and studied in daily subcutaneous injection formulations for central precocious puberty, prostate cancer, and endometriosis [8, 9]. The compound was subsequently reformulated by Roberts Laboratories (later acquired by Shire Pharmaceuticals, then Endo Pharmaceuticals) into a diffusion-controlled hydrogel polymer reservoir subcutaneous implant delivering approximately 65 micrograms of histrelin acetate per day over 12 months [10, 11]. This implant technology produced two FDA-approved products: Vantas (50 mg histrelin acetate implant for palliative treatment of advanced prostate cancer, approved October 2004) and Supprelin LA (50 mg histrelin acetate implant for central precocious puberty, approved May 2007) [12, 13]. Vantas was discontinued in 2020 owing to manufacturing quality issues at the production facility; Supprelin LA remains commercially available. Pharmacokinetics of the implant formulation are characterized by sustained zero-order drug release producing median steady-state serum histrelin concentrations of approximately 0.2 to 0.4 ng/mL, with a terminal elimination half-life of the released peptide of approximately 4 hours, 92 percent subcutaneous bioavailability, and approximately 70 percent plasma protein binding [10, 14]. Metabolism is hepatic through peptidase-mediated degradation. The adverse-event profile is dominated by the pharmacological consequences of gonadal steroid suppression: hot flashes, reduced libido, erectile dysfunction or amenorrhea, and long-term bone mineral density reduction. Implant site reactions (bruising, pain, erythema) occur in approximately 50 percent of recipients. The initial flare phase carries specific risk in metastatic prostate cancer, which is mitigated by co-administration of an antiandrogen during the first 2 to 4 weeks of therapy. Postmarketing surveillance has identified rare but serious adverse events including pseudotumor cerebri, seizures, psychiatric symptoms (emotional lability, depression, suicidal ideation), and severe cutaneous adverse reactions. This monograph reviews the chemistry and synthesis, the biphasic GnRH receptor pharmacology, the comprehensive human pharmacokinetic record, the clinical evidence base across prostate cancer, central precocious puberty, endometriosis, and gender-affirming therapy indications, sourcing and quality verification, reconstitution and handling, stack interactions, adverse-event signal, and a comparative assessment of five GnRH agonist candidates against histrelin on five competency standards.

Read the full monograph

The full reference document covers compound identification, discovery and developmental history, mechanism of action, pharmacokinetics, sourcing and quality verification, and a curated reference list. Embedded inline below; download for offline reading.

KDC-MN-1397Open in new tab →

Download PDF →

FOR RESEARCH USE ONLY. Not for medical, diagnostic, or therapeutic purposes. Not for human consumption. All information is provided for research and educational purposes only.

May 10, 2026
Lotiglipron

Our opinion on this compoundNiche research probe

48/100

Discontinued oral small-molecule GLP-1R agonist with real Phase 2 data and a program-ending hepatic liability

Look, lotiglipron is one of those compounds that’s worth understanding, but not because you’d anchor a research program around it today. Pfizer’s PF-07081532 was a serious attempt at oral small-molecule GLP-1R agonism using Sosei Heptares StaR technology, which gave the design team crystallographic access to the receptor’s transmembrane domain in a conformation stable enough for real structure-based work. That’s not a trivial achievement. The binding mode is transmembrane rather than extracellular, unlike peptide GLP-1R agonists, and that pharmacological distinction is genuinely worth caring about if you’re trying to understand functional selectivity and signaling bias at GLP-1R.

Phase 2 confirmed what the mechanism predicted: glucose lowering and a weight reduction signal in both T2D and obesity cohorts. The PK was actually attractive, a half-life of 21 to 27 hours with once-daily dosing and no fasting requirement, which would have been a competitive advantage in the oral incretin space. But the program ended in 2023 when hepatic transaminase elevations appeared in a subset of participants at sufficient frequency to close the Pfizer filing. That fact now organizes almost everything scientifically interesting about lotiglipron. The efficacy is predictable from the mechanism and not especially notable. The hepatotoxicity is the open question.

Thats where the bench value sits right now. If you’re working on the oral nonpeptide GLP-1R agonist class, you need to understand the hepatic liability profile, and lotiglipron is one of the two major clinical data points (danuglipron being the other, also Pfizer, also discontinued in the same period) that define the problem. Orforglipron from Lilly is the surviving frontrunner and appears to be clearing the hepatic hurdle that lotiglipron did not. Understanding why is a legitimate, unresolved mechanistic question with real clinical implications for the whole class.

The differentiation picture is genuinely poor. Orforglipron has a better safety trajectory, Phase 3 enrollment underway, and owns the class from a development standpoint. Lotiglipron’s interest is comparative and structural, not competitive. For investigators studying GPCR transmembrane domain pharmacology, the compound comes with a clinical dataset attached, which is unusual and useful. For anyone wanting to run a GLP-1R agonism program, its not the starting point.

We also dont love the evidence situation. The Phase 2 data is real and multi-site, but the program was terminated before replication could accumulate. The hepatic signal is documented but the underlying mechanism, whether it’s metabolite-mediated, target-related, or idiosyncratic, remains unresolved. Useful for comparison. Not compelling as a primary object of investigation unless hepatic liability in small-molecule GPCR agonists is your specific question.

Novelty

60

Mechanism promise

58

In-category differentiation

28

Evidence quality

50

Translational signal

40

Research bench value

50

Rationale Lotiglipron sits in an unusual position: a genuinely novel-class compound discontinued for safety rather than efficacy failure, giving it residual research value as a comparative probe for hepatotoxicity in oral small-molecule GLP-1R agonists. Differentiation scores low because orforglipron has a stronger safety trajectory and defines the class; lotiglipron’s primary scientific interest is now forensic rather than developmental.

Editorial commentary from Kodiac biolabs. Not a recommendation, not clinical advice. Research use only.

Oral nonpeptide small-molecule glucagon-like peptide-1 receptor agonist

A selective, potent, orally bioavailable small-molecule agonist of the human glucagon-like peptide-1 receptor developed by Pfizer using Sosei Heptares stabilized-receptor technology, advanced through Phase 2 for type 2 diabetes and obesity, and subsequently discontinued owing to hepatic transaminase elevations in a subset of treated participants.

Abstract

Lotiglipron (PF-07081532) is an orally administered, nonpeptide, small-molecule agonist of the human glucagon-like peptide-1 receptor (GLP-1R) developed by Pfizer in collaboration with Sosei Heptares. The compound was designed through structure-based drug design leveraging Sosei Heptares proprietary StaR (stabilized receptor) technology platform, which enables crystallographic resolution of G-protein-coupled receptor conformations that are otherwise too unstable for conventional structural characterization. Lotiglipron binds within the transmembrane domain of the GLP-1R, activating the Gs-coupled adenylyl cyclase signaling cascade and increasing intracellular cyclic adenosine monophosphate (cAMP) in a manner functionally analogous to the endogenous incretin peptide GLP-1(7-36)amide but with the pharmacokinetic advantages of oral bioavailability, once-daily dosing without fasting requirements, and a plasma elimination half-life of approximately 21 to 27 hours that supports sustained receptor engagement across the dosing interval.

The compound entered clinical development in 2021 and was advanced through two Phase 1 multiple-ascending-dose studies (Buckeridge et al. 2024) in 74 participants with type 2 diabetes mellitus (T2D) and 26 participants with obesity without diabetes, demonstrating dose-proportional pharmacokinetics across a 10 to 180 mg once-daily dose range, dose-dependent reductions in glycated hemoglobin (HbA1c) of up to 1.61 percentage points at the 180 mg dose over 42 days, and a safety and tolerability profile consistent with the GLP-1R agonist mechanism class. These findings supported advancement to a Phase 2 dose-ranging study (Amin et al. 2025) in 901 participants (512 with T2D, 389 with obesity), which demonstrated statistically significant reductions in HbA1c of up to 1.44 percentage points (80 mg dose, 16 weeks) and body weight reductions of up to 7.47 percent (200 mg dose, 20 weeks). The Phase 2 study included an open-label semaglutide 14 mg comparator arm; lotiglipron at doses above 20 mg produced HbA1c reductions numerically comparable to or exceeding semaglutide at week 16. However, the Phase 2 study was terminated early following identification of hepatic transaminase elevations (alanine aminotransferase and/or aspartate aminotransferase greater than 3 times the upper limit of normal) in 6.0 to 6.6 percent of lotiglipron-treated participants versus 1.6 percent on placebo, with some individuals reaching elevations greater than 8 times the upper limit of normal. No cases of liver failure, symptomatic hepatitis, or Hy’s law were reported. In June 2023, Pfizer announced discontinuation of the lotiglipron clinical program based on the transaminase signal, pharmacokinetic data from Phase 1 drug-drug-interaction studies suggesting impaired hepatic drug transport or metabolism in a subset of participants, and the inability to prospectively identify at-risk individuals.

Lotiglipron is structurally characterized as a benzimidazole-piperidinyl-benzodioxole derivative bearing a chloropyridinyl substituent and an oxetanylmethyl group (molecular formula C31H31ClN4O5, molecular weight 575.05 g/mol as free base; CAS 2401892-75-7). The compound is not approved in any jurisdiction and is not in active clinical development. Research-grade lotiglipron is available from multiple chemical suppliers and remains a tool compound for the investigation of small-molecule GLP-1R agonist pharmacology, biased signaling, and hepatic metabolism of the oral GLP-1R agonist class. This monograph reviews the chemistry, synthesis, receptor pharmacology, pharmacokinetics, preclinical and clinical evidence, sourcing and handling, stack interactions, adverse events, and a comparative assessment against five oral or nonpeptide GLP-1R agonist candidates on five competency standards.

Read the full monograph

The full reference document covers compound identification, discovery and developmental history, mechanism of action, pharmacokinetics, sourcing and quality verification, and a curated reference list. Embedded inline below; download for offline reading.

KDC-MN-1409Open in new tab →

Download PDF →

FOR RESEARCH USE ONLY. Not for medical, diagnostic, or therapeutic purposes. Not for human consumption. All information is provided for research and educational purposes only.

May 10, 2026
Pemvidutide

Our opinion on this compoundNovel frontier

70/100

Balanced GLP-1/GCGR dual agonist with exceptional Phase 2b MASH biopsy data and FDA Breakthrough Therapy Designation

Look, the GLP-1 receptor agonist story has been told. Semaglutide changed metabolic medicine. Tirzepatide added GIP and extended the effect. What pemvidutide does is point the second receptor somewhere different: straight at the liver. The glucagon receptor axis drives hepatic fatty acid beta-oxidation and suppresses de novo lipogenesis directly, producing a pharmacology that is mechanistically suited to MASH in a way that a GLP-1-only agent isn’t. The 1:1 GLP-1R/GCGR co-agonism ratio is deliberate: glucagon raises glucose, GLP-1 counters it, and the net glycemic result is approximately neutral at therapeutic doses. That’s an elegant design choice that lets the compound go after the liver without glycemic misfires in a metabolically fragile population.

The EuPort glycolipid conjugation is worth noting on its own terms. The 18-carbon diacid alkyl chain creates near-quantitative but transient albumin binding that extends plasma half-life to weekly dosing without a titration requirement. That’s a real formulation engineering advance, and it’s structurally distinct from the fatty diacid chemistry semaglutide uses, making it an interesting probe for half-life extension strategy comparisons as well.

The clinical signal is what puts this compound on the priority list. In the Phase 1b/2a MASLD study (Harrison et al. 2025), 1.8 mg weekly produced a 68.5% relative reduction in liver fat by MRI-PDFF at 12 weeks, extending to 75.2% at 24 weeks. Those are not modest numbers. The Phase 2b IMPACT trial in 212 biopsy-confirmed MASH patients with F2-F3 fibrosis is the bigger story: 59.1% MASH resolution without fibrosis worsening at 1.2 mg versus 19.1% for placebo (p less than 0.0001). For context, resmetirom’s MASH approval was built on roughly 26% histological response rates. The FDA recognized the signal: Breakthrough Therapy Designation was granted in January 2026, alongside Fast Track for both MASH and AUD.

On the obesity side, the MOMENTUM trial showed 15.6% weight loss at 48 weeks, with 78.1% of that loss attributable to fat mass. Thats competitive with tirzepatide at comparable durations, though head-to-head data doesnt exist. The AUD indication is genuinely novel and the preclinical alcohol preference model is interesting, but human evidence there is still thin.

What we like: the GCGR-directed liver mechanism is real and well-differentiated from approved agents, the IMPACT biopsy data is exceptional for a Phase 2b readout, and BTD is a serious signal that the FDA considers the data compelling. What we don’t like: Phase 3 hasn’t run yet, Altimmune is a smaller shop operating in a space dominated by Novo Nordisk and Lilly, and survodutide plus other GLP-1/GCGR programs are actively competing. The evidence base is strong for its stage but not yet replicated across independent groups. For investigators studying MASH biology, incretin co-agonism, or liver-targeted metabolic pharmacology, this is one of the more interesting compounds in active clinical development right now.

Novelty

68

Mechanism promise

80

In-category differentiation

70

Evidence quality

62

Translational signal

77

Research bench value

60

Rationale Pemvidutide scores high on mechanism (deliberate 1:1 GLP-1R/GCGR co-agonism with liver-directed hepatic fat oxidation) and translational signal (59.1% biopsy-confirmed MASH resolution vs 19.1% placebo in the IMPACT Phase 2b, BTD granted January 2026). Pre-Phase 3 status, a competitive incretin landscape, and single-sponsor clinical data limit the ceiling on novelty and evidence scores.

Editorial commentary from Kodiac biolabs. Not a recommendation, not clinical advice. Research use only.

Balanced dual glucagon-like peptide-1 (GLP-1) and glucagon receptor agonist peptide with glycolipid half-life extension

A 29-amino-acid unimolecular peptide engineered for equipotent GLP-1 and glucagon receptor co-agonism, conjugated to a proprietary glycolipid moiety for weekly subcutaneous dosing, under clinical development for metabolic dysfunction-associated steatohepatitis, obesity, and alcohol use disorder.

Abstract

Pemvidutide (ALT-801; CAS 2538014-94-5; UNII A35F525WBG; molecular formula C182H275N39O54; molecular weight 3873.42 g/mol) is a synthetic 29-amino-acid peptide that functions as a balanced (1:1) dual agonist of the glucagon-like peptide-1 receptor (GLP-1R) and the glucagon receptor (GCGR), developed by Altimmune, Inc. (Gaithersburg, Maryland) for the treatment of metabolic dysfunction-associated steatohepatitis (MASH), obesity, alcohol use disorder (AUD), and alcohol-associated liver disease (ALD). The compound incorporates sequence elements derived from both GLP-1 and glucagon and is conjugated to an 18-carbon diacid alkyl chain through a proprietary glycosidic linkage (designated EuPort), which provides near-quantitative but transient binding to serum albumin and extends the plasma half-life to a duration consistent with once-weekly subcutaneous administration without dose titration [1, 2]. The dual receptor mechanism differentiates pemvidutide from selective GLP-1 receptor agonists such as semaglutide and liraglutide: GLP-1R activation suppresses appetite through hypothalamic and brainstem satiety circuits, delays gastric emptying, and improves glycemic control, while GCGR activation directly stimulates hepatic fatty acid beta-oxidation, suppresses de novo lipogenesis, and increases energy expenditure through thermogenic pathways, producing a composite antisteatotic and weight-reducing pharmacology that is mechanistically suited to liver-predominant metabolic disease [3, 4, 5]. In the translational AMLN diet-induced obese mouse model of NASH, pemvidutide at 10 nmol/kg subcutaneous produced approximately 25 percent body weight reduction, significant reductions in liver triglycerides, galectin-3, collagen type 1 alpha 1, and NAFLD Activity Score, with efficacy exceeding that of semaglutide and elafibranor at equimolar doses on composite histological endpoints [6]. Clinical development has advanced through Phase 1 studies (NCT04561245, 100 subjects), Phase 1b/2a studies in MASLD (NCT05006885, 95 subjects; NCT05292911, 64 subjects), the Phase 2 MOMENTUM obesity trial (391 subjects, 48 weeks), and the Phase 2b IMPACT trial in biopsy-confirmed MASH (NCT05989711, 212 subjects) [1, 7, 8, 9, 10]. In the Phase 1b/2a MASLD study (Harrison et al. 2025), 12 weeks of pemvidutide at 1.8 mg weekly produced a 68.5 percent relative reduction in liver fat content by MRI-proton density fat fraction versus 4.4 percent for placebo (p < 0.001), with 55.6 percent of treated subjects achieving liver fat normalization to 5 percent or below [8]. Extension to 24 weeks produced 75.2 percent liver fat reduction at 1.8 mg and 6.2 percent body weight reduction versus placebo [7]. In the MOMENTUM trial, pemvidutide at 2.4 mg weekly for 48 weeks produced mean weight loss of 15.6 percent versus 2.2 percent on placebo, with body composition analysis demonstrating 78.1 percent of weight loss attributable to fat mass and 21.9 percent to lean mass [9, 10]. In the Phase 2b IMPACT trial (Noureddin et al. 2025) in 212 patients with biopsy-confirmed MASH and fibrosis stages F2 or F3, pemvidutide met the primary endpoint of MASH resolution without fibrosis worsening: 59.1 percent at 1.2 mg and 52.1 percent at 1.8 mg versus 19.1 percent for placebo (p < 0.0001 for both comparisons) [11]. Topline 48-week data demonstrated continued antifibrotic activity with statistically significant improvements in Enhanced Liver Fibrosis score and liver stiffness measurement versus placebo [12]. The United States Food and Drug Administration has granted Breakthrough Therapy Designation for pemvidutide in MASH (January 2026) and Fast Track designations for both MASH and AUD [13, 14]. Phase 3 registrational programs for MASH and the VELOCITY Phase 3 program for obesity are in planning as of May 2026. Safety across completed trials has been favorable; adverse events are predominantly gastrointestinal (nausea, diarrhea, decreased appetite), mild to moderate in severity, and concentrated in the first 16 weeks of treatment. No imbalances in cardiac events, arrhythmias, or clinically meaningful heart rate increases have been observed. This monograph reviews the compound identification, structural pharmacology, mechanism of action, pharmacokinetics, preclinical and clinical evidence base, sourcing and quality verification, reconstitution and handling, stack interactions, adverse events, and a comparative assessment of five alternative agents (survodutide, semaglutide, tirzepatide, cotadutide, resmetirom) against pemvidutide on five competency standards.

Read the full monograph

The full reference document covers compound identification, discovery and developmental history, mechanism of action, pharmacokinetics, sourcing and quality verification, and a curated reference list. Embedded inline below; download for offline reading.

KDC-MN-1410Open in new tab →

Download PDF →

FOR RESEARCH USE ONLY. Not for medical, diagnostic, or therapeutic purposes. Not for human consumption. All information is provided for research and educational purposes only.

May 10, 2026
Elabela

Our opinion on this compoundNovel, promising

56/100

Novel endogenous APJ ligand with broad preclinical signal but zero interventional human data

Look, the apelinergic system has been a quiet but serious area of cardiovascular research for two decades, and Elabela’s 2013 arrival complicated the story in the best possible way. It’s not just a second apelin analog. The peptide shares less than 25 percent sequence identity with apelin, has a completely different spatiotemporal expression pattern, and produces distinct signaling bias at the same APJ receptor. That’s a genuinely interesting pharmacological problem, not a trivial me-too situation.

The mechanism is what we like most here. ELA-32 activates Gi/o-coupled inhibition of adenylyl cyclase while also hitting ERK1/2, PI3K/AKT/mTOR, intracellular calcium, and beta-arrestin recruitment, functioning as a balanced agonist across G-protein and beta-arrestin arms. That balance is itself a research question worth pursuing: apelin analogs have been engineered toward G-protein bias to improve cardiovascular outcomes, and Elabela’s native balanced profile gives investigators a clean pharmacological comparator. The IC50 at the human APJ receptor is around 0.27 nanomolar. Thats tight binding with a half-life of roughly 47 minutes in human plasma, which is a meaningful PK advantage over apelin-13’s approximately 5-minute in vivo half-life.

The preclinical evidence base is genuinely multi-system and comes from more than one lab group, which is more than we can say for a lot of peptides in this space. Cardiovascular protection across MI, ischemia-reperfusion, and hypertensive fibrosis models; renal protection through renin-angiotensin antagonism in salt-sensitive hypertension; attenuation of right ventricular hypertrophy in PAH models; neuronal protection in ischemic stroke via APJ-dependent anti-apoptotic signaling. The preeclampsia angle in the ELA knockout mouse is one of the more compelling obstetric mechanism stories we’ve seen in peptide pharmacology, and the CRISPR-validated hESC self-renewal data from Ho et al. adds a stem cell biology dimension thats rare in this literature.

Here’s the thing though: there are no completed human interventional trials. None. The human evidence is observational and biomarker-level only. That isn’t a death sentence for a research compound but it does mean the translational arrow is still pointing from bench to clinic, not back again, and we have to score it accordingly. The half-life limitation also remains real despite the plasma stability advantage over apelin: renal degradation is fast (half-life under a minute in kidney homogenates), which matters given the renoprotective applications, and Fc-fusion and PEGylated analogs are still preclinical tools, not validated delivery platforms.

We think Elabela earns its place in a serious apelinergic research program as both a probe and a candidate. The signaling bias story and the multi-system phenotypes make it more interesting than most second-ligand discoveries. But the complete absence of human interventional data is a hard ceiling on how excited we can be right now. Preclinical signal is real. Clinical signal: still pending.

Novelty

65

Mechanism promise

68

In-category differentiation

60

Evidence quality

42

Translational signal

30

Research bench value

65

Rationale Elabela scores solidly on novelty and mechanism for a peptide discovered in 2013 with genuinely distinct biology from apelin at the same receptor, spanning cardiovascular development, preeclampsia, and stem cell self-renewal; the drag is complete absence of interventional human data and the preclinical-only evidence base, which prevents this from reaching the upper novel-promising tier despite real multi-lab support.

Editorial commentary from Kodiac biolabs. Not a recommendation, not clinical advice. Research use only.

Endogenous peptide hormone and apelin receptor (APJ/APLNR) agonist of the apelinergic signaling system

A 32-amino-acid secreted peptide hormone discovered in 2013 as the second endogenous ligand of the apelin receptor (APJ/APLNR), essential for vertebrate cardiovascular morphogenesis, human embryonic stem cell self-renewal, placental angiogenesis, and renal fluid homeostasis, with preclinical cardioprotective, renoprotective, antihypertensive, and neuroprotective activity across multiple disease models.

Abstract

Elabela (ELA), also designated Apela, Toddler, and Ende, is a secreted peptide hormone encoded by the APELA gene on human chromosome 4q32.3. The gene encodes a 54-amino-acid preproprotein containing a 22-residue signal peptide; cleavage yields the 32-amino-acid mature peptide ELA-32 (sequence QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP), which may be further processed by proprotein convertases to generate the bioactive isoforms ELA-21 and ELA-11 [1, 2]. Elabela was discovered independently by two groups in 2013 and 2014: Chng et al. (2013) identified the peptide in zebrafish as a hormone essential for heart development signaling through the apelin receptor (APLNR/APJ), while Pauli et al. (2014) characterized the same molecule as “Toddler,” an embryonic signal promoting mesodermal cell migration [1, 3]. The peptide is the second endogenous ligand of the apelin receptor, a class A G-protein-coupled receptor previously known to bind only apelin; despite sharing a common receptor, Elabela and apelin exhibit less than 25 percent sequence similarity and display distinct spatiotemporal expression profiles and partially divergent signaling bias [4, 5]. Elabela activates the apelin receptor through Gi/o-coupled inhibition of adenylyl cyclase, stimulation of ERK1/2 and PI3K/AKT/mTOR pathways, mobilization of intracellular calcium, and recruitment of beta-arrestin, functioning as a balanced agonist across G-protein-dependent and beta-arrestin-dependent pathways [5, 6]. The binding affinity of ELA-32 for the human apelin receptor is high, with reported IC50 values of approximately 0.27 nanomolar and Kd values of approximately 0.51 nanomolar [7]. Physiologically, Elabela is expressed at high levels during embryogenesis across vertebrate species and in adult tissues with restricted distribution, principally kidney (collecting ducts and loops of Henle), prostate, and vascular endothelium [2, 8]. The peptide is essential for vertebrate cardiovascular development: genetic ablation of Elabela in zebrafish produces severe cardiac malformations including rudimentary or absent hearts, phenocopying loss of the apelin receptor itself [1]. In mice, Elabela knockout produces preeclampsia-like symptoms during pregnancy including proteinuria, hypertension, defective placental angiogenesis, and reduced fetal weight, effects that are rescued by exogenous ELA infusion [9]. A separate demonstration by Ho et al. (2015) established that Elabela is an endogenous growth factor sustaining human embryonic stem cell self-renewal via the PI3K/AKT pathway, with CRISPR-mediated deletion causing loss of pluripotency and cell death [10]. In the adult cardiovascular system, Elabela functions as an endogenous agonist of the apelin receptor producing positive inotropy, vasodilation, increased cardiac output, and depressor responses comparable to apelin; expression is downregulated in pulmonary arterial hypertension, and exogenous administration attenuates right ventricular hypertrophy and pulmonary vascular remodeling in monocrotaline-exposed rats [11]. Preclinical cardioprotective activity has been demonstrated across myocardial infarction, ischemia-reperfusion injury, and hypertensive cardiac fibrosis models, operating through PI3K/AKT-mediated anti-apoptotic, anti-fibrotic, and pro-angiogenic mechanisms [12, 13, 14]. Renoprotective activity is characterized by antagonism of the intrarenal renin-angiotensin system, reduction of blood pressure and albuminuria in salt-sensitive hypertensive rats, and prevention of vasopressin-induced aquaporin-2 translocation in collecting duct principal cells, thereby promoting aqueous diuresis [15, 16]. Neuroprotective activity has been demonstrated in rodent models of ischemic stroke, where ELA attenuates neuronal apoptosis, ferroptosis, and pyroptosis through APJ-dependent signaling cascades [17, 18]. The in vitro plasma half-life of ELA-32 in human plasma is approximately 47 minutes, substantially longer than that of apelin-13 (approximately 5 minutes in vivo), though rapid degradation occurs in kidney homogenates (half-life approximately 44 seconds), and the short systemic half-life has motivated the development of Fc-fusion, PEGylated, and acylated analogs with extended duration of action [19, 20, 21]. No human clinical trials of exogenous Elabela administration have been completed as of the monograph revision date; the compound remains in the preclinical-to-translational research phase. This monograph reviews the chemistry, isoform biology, and synthesis of Elabela; the receptor pharmacology and signaling mechanisms in molecular detail; the pharmacokinetic profile including metabolism and stability-enhancement strategies; the preclinical evidence base across cardiovascular, renal, obstetric, stem cell, neurological, and oncological applications; sourcing and quality verification for research-grade material; reconstitution and handling; stack-interaction considerations; the adverse-event and safety signal from animal studies; and a comparative assessment of five apelinergic system candidates against Elabela on five competency standards.

Read the full monograph

The full reference document covers compound identification, discovery and developmental history, mechanism of action, pharmacokinetics, sourcing and quality verification, and a curated reference list. Embedded inline below; download for offline reading.

KDC-MN-1385Open in new tab →

Download PDF →

FOR RESEARCH USE ONLY. Not for medical, diagnostic, or therapeutic purposes. Not for human consumption. All information is provided for research and educational purposes only.

May 10, 2026
Glepaglutide

Our opinion on this compoundEstablished, active research

55/100

Well-engineered second-gen GLP-2 analog with real Phase 3 data but contested regulatory status and modest novelty

Glepaglutide is a serious piece of pharmaceutical engineering sitting in a crowded second-generation GLP-2 space. Zealand Pharma built it using their Structure Inducing Probe (SIP) technology: nine amino acid substitutions to native GLP-2(1-33) plus a C-terminal hexalysine tail that drives depot formation subcutaneously, extending the half-life to 50 to 124 hours versus roughly 7 hours for teduglutide. The result is twice-weekly or once-weekly dosing instead of daily injections. Thats a real patient-facing advance, and the peptide engineering behind it is genuinely clever.

The mechanism is well-understood, and thats not a knock against it. GLP-2R is a Class B GPCR expressed on intestinal subepithelial myofibroblasts and enteric neurons; activation drives IGF-1 and EGF release, crypt proliferation, villus elongation, and increased absorptive capacity in anatomically shortened bowel. For short bowel syndrome patients dependent on parenteral support, this is a legitimate and important target. What glepaglutide doesnt do is introduce a genuinely new mechanism; it executes established GLP-2 pharmacology more elegantly, which matters clinically but limits the novelty argument considerably.

The clinical picture is mixed in ways worth sitting with. The EASE-SBS 1 Phase 3 trial (NCT03690206) enrolled 106 patients in a multinational double-blind design and met its primary endpoint: mean weekly parenteral support reduction of 5.13 liters for twice-weekly glepaglutide versus 2.85 liters for placebo (P = 0.0039). Real signal in a genuinely difficult disease. But the December 2024 FDA Complete Response Letter, citing insufficient evidence at the proposed dose and requesting a confirmatory trial, is a meaningful complication. EMA MAA was filed June 2025 and remains pending. We think this is mostly a dosing question rather than a signal failure, but the regulatory uncertainty is real and the confirmatory trial timeline stretches the horizon.

In the competitive context, glepaglutide runs alongside apraglutide (VectivBio/Ironwood), dapiglutide, and elsiglutide in what’s becoming a contested next-gen GLP-2 field. The ready-to-use liquid formulation and extended dosing interval are real differentiators over teduglutide, but no candidate has pulled clearly ahead yet. For bench investigators, the SIP depot-forming technology is interesting as a model for sustained-release peptide delivery. The active metabolite characterization (M1 at 35 residues, M2 at 34 residues) leaves genuine questions about partial agonism and metabolite contribution that havent been fully resolved, and the GLP-2R anti-inflammatory biology in IBD models is underexplored. Honestly, glepaglutide scores well on execution and clinical discipline, less well on novelty and frontier position. Its a well-characterized research candidate for investigators already working in intestinal biology, with less to offer as a discovery-mode target.

Novelty

55

Mechanism promise

50

In-category differentiation

55

Evidence quality

60

Translational signal

62

Research bench value

45

Rationale Glepaglutide’s SIP-technology depot engineering is genuinely clever and the Phase 3 EASE-SBS 1 trial met its primary endpoint, but the GLP-2 mechanism has been established since teduglutide’s 2012 approval and the December 2024 FDA Complete Response Letter signals evidence gaps at the proposed dose. Scores at the high end of established-active territory: solid clinical discipline in a narrow orphan indication, held back by limited novelty, a contested next-gen GLP-2 field, and unresolved regulatory status.

Editorial commentary from Kodiac biolabs. Not a recommendation, not clinical advice. Research use only.

Long-acting glucagon-like peptide-2 (GLP-2) receptor agonist peptide analog

A 39-amino-acid synthetic peptide analog of human glucagon-like peptide-2 engineered by Zealand Pharma with nine amino acid substitutions and a C-terminal hexalysine tail to enable depot formation, extended half-life, and ready-to-use liquid formulation for subcutaneous administration in short bowel syndrome.

Abstract

Glepaglutide (ZP1848) is a long-acting, synthetic peptide analog of human glucagon-like peptide-2 (GLP-2) developed by Zealand Pharma A/S (Soeborg, Denmark) for the treatment of short bowel syndrome (SBS) with intestinal failure in patients dependent on parenteral support. The compound comprises 39 amino acids and differs from native human GLP-2(1-33) by the incorporation of nine amino acid substitutions at positions 2, 3, 5, 8, 10, 11, 16, 24, and 28, together with a C-terminal amidated hexalysine tail ([Lys]6-NH2) derived from Zealand Pharma’s proprietary Structure Inducing Probe (SIP) technology. The substitutions confer resistance to dipeptidyl peptidase-4 (DPP-4) degradation, improved physicochemical stability enabling a ready-to-use aqueous liquid formulation, and formation of a subcutaneous depot from which the parent compound and its active C-terminally truncated metabolites (M1, 35 amino acids; M2, 34 amino acids) are slowly released into systemic circulation. The resulting effective half-life of approximately 50 to 124 hours in humans permits twice-weekly or once-weekly subcutaneous dosing, a substantial advance over the daily injection requirement of teduglutide (Gattex), the first-in-class approved GLP-2 analog. Glepaglutide binds and activates the GLP-2 receptor (GLP-2R), a class B G-protein-coupled receptor expressed on intestinal subepithelial myofibroblasts, enteroendocrine cells, and enteric neurons. Receptor activation triggers downstream release of intestinal growth mediators including insulin-like growth factor-1 (IGF-1), epidermal growth factor (EGF), and keratinocyte growth factor, resulting in crypt cell proliferation, villus elongation, inhibition of enterocyte apoptosis, enhanced intestinal barrier function, increased mesenteric blood flow, and suppression of gastric acid hypersecretion and accelerated gastrointestinal motility. The net physiological effect is increased intestinal absorptive capacity for fluid, electrolytes, and macronutrients in patients with anatomically shortened bowel. Clinical development has progressed through Phase 1 healthy volunteer pharmacokinetic studies, a Phase 2 randomized crossover trial in 18 SBS patients published in The Lancet Gastroenterology and Hepatology (Naimi et al., 2019) demonstrating dose-dependent improvements in intestinal wet weight absorption and plasma citrulline, and the pivotal Phase 3 EASE-SBS 1 trial (NCT03690206), a multinational, double-blind, placebo-controlled study in 106 patients that met its primary endpoint of significant reduction in weekly parenteral support volume at 24 weeks (mean change minus 5.13 versus minus 2.85 liters per week for glepaglutide twice weekly versus placebo; P equals 0.0039). The compound received orphan drug designation from both the United States Food and Drug Administration and the European Medicines Agency. Zealand Pharma submitted a New Drug Application to the FDA in late 2023; in December 2024, the FDA issued a Complete Response Letter citing insufficient evidence to confirm efficacy and safety at the proposed marketed dose and recommending an additional confirmatory trial. A Marketing Authorization Application was submitted to the European Medicines Agency in June 2025, and Zealand Pharma plans an additional Phase 3 trial to support regulatory resubmission in the United States. The safety profile is consistent with the known GLP-2 class effects. The most frequent adverse events in clinical trials are injection site reactions, stoma complications (primarily swelling or enlargement of the stoma nipple), gastrointestinal events (nausea, vomiting, abdominal pain), peripheral edema, fatigue, and headache. Anti-drug antibodies develop in a proportion of treated patients with a trend toward higher injection site reaction incidence in antibody-positive individuals, though no firm causal relationship has been established. The compound does not require reconstitution and is administered as a fixed-dose, ready-to-use subcutaneous injection via autoinjector, representing a practical advantage over lyophilized GLP-2 analogs requiring daily preparation. This monograph documents the chemistry, design rationale, and synthesis of glepaglutide; the GLP-2 receptor pharmacology and downstream intestinotrophic signaling; the comprehensive human pharmacokinetic profile including depot formation and metabolite characterization; the preclinical pharmacology in intestinal growth and inflammatory bowel disease models; the clinical evidence base from Phase 1 through Phase 3; sourcing and quality verification; reconstitution and handling; stack interaction considerations; adverse events and safety signals; and a comparative assessment of five GLP-2 receptor agonist candidates (teduglutide, apraglutide, dapiglutide, elsiglutide, and native GLP-2) against glepaglutide on five competency standards.

Read the full monograph

The full reference document covers compound identification, discovery and developmental history, mechanism of action, pharmacokinetics, sourcing and quality verification, and a curated reference list. Embedded inline below; download for offline reading.

KDC-MN-1414Open in new tab →

Download PDF →

FOR RESEARCH USE ONLY. Not for medical, diagnostic, or therapeutic purposes. Not for human consumption. All information is provided for research and educational purposes only.

May 10, 2026
Octreotide

Our opinion on this compoundEstablished workhorse

52/100

The canonical SSTR2-selective reference compound, clinically mature with real bench utility but little frontier novelty

Look, octreotide is one of those compounds where the sheer weight of clinical evidence almost works against it as a research target. Bauer and colleagues at Sandoz synthesized SMS 201-995 in 1982, the FDA approved it in 1988, and by now the somatostatin receptor subtype 2 pharmacology it illuminated has been exhaustively characterized. We know the binding kinetics cold: Ki approximately 0.4 to 0.6 nanomolar at SSTR2, roughly 7 nanomolar at SSTR5, negligible at SSTR1 and SSTR4. The Gi-coupled downstream cascade, adenylyl cyclase inhibition, reduced cAMP, suppression of GH and the splanchnic peptide circus, its all textbook material at this point.

What octreotide genuinely has going for it is bench value as a reference probe. If you’re doing SSTR subtype selectivity work, you need octreotide in the comparison panel. The PROMID trial data (Rinke et al. 2009, HR 0.34, p equal to 0.000072 on time to tumor progression in midgut NETs) is clean and credible. The PK record after subcutaneous dosing, peak at 25 to 30 minutes, bioavailability near 100 percent, t1/2 roughly 90 to 120 minutes, is mature enough to serve as a reference standard for half-life extension strategies in the cyclic peptide space. The 2020 oral Mycapssa approval is genuinely interesting from a formulation-science angle, even if the compound underneath is old news.

Here’s the thing though: the research frontier in the somatostatin axis has moved. Pasireotide, with its broader SSTR1/2/3/5 profile, is the more interesting pharmacological object for investigators interested in Cushing’s disease and escape mechanisms. Lu-177 DOTATATE has repositioned the entire NET field around theranostic radiopharmaceuticals, and the octreotide scaffold underpins that ligand family as a structural starting point rather than a target in its own right. Paltusotine is the oral non-peptide SSTR2 agonist that will eventually displace octreotide in clinical maintenance, and it raises much more interesting SAR questions. Octreotide itself is mostly the molecule you reach for when you need to define what SSTR2-selective engagement looks like, not the molecule anyone is running a serious exploratory program around in 2026.

We think its place in a research library is legitimate but specific: its a comparator, a reference point, a structural ancestor. The evidence quality and translational signal scores are high because decades of human data dont lie. But the novelty and mechanism scores honestly reflect that theres very little left to discover here. Serious bench investigators in the somatostatin space will use it; they just wont be excited about it.

Novelty

22

Mechanism promise

38

In-category differentiation

50

Evidence quality

78

Translational signal

78

Research bench value

62

Rationale Octreotide scores strongly on evidence and translational signal because it is an FDA-approved drug with replicated phase 3 data and decades of clinical use, but those same facts drive novelty and mechanism scores to the floor. The compound is 40+ years old and the SSTR2 pharmacology it opened is now thoroughly characterized; the primary research question for the field has shifted to broader-subtype agents, radiolabeled conjugates, and oral non-peptide agonists, leaving octreotide as an indispensable reference probe rather than a live research frontier.

Editorial commentary from Kodiac biolabs. Not a recommendation, not clinical advice. Research use only.

Synthetic cyclic octapeptide somatostatin analog with preferential binding to somatostatin receptor subtypes 2 and 5

A disulfide-bridged octapeptide analog of hypothalamic somatostatin-14 developed at Sandoz as SMS 201-995, distinguished from the native hormone by a 30-fold increase in inhibition of growth hormone release relative to insulin suppression and an elimination half-life extended from under 3 minutes to approximately 100 minutes after subcutaneous administration.

Abstract

Octreotide (SMS 201-995) is a synthetic cyclic octapeptide analog of somatostatin-14 that reproduces the pharmacologically essential tetrapeptide core (Phe-Trp-Lys-Thr) of the native hormone within a conformationally constrained disulfide-bridged ring, yielding a compound with high-affinity binding at somatostatin receptor subtype 2 (SSTR2; Ki approximately 0.4 to 0.6 nanomolar), moderate affinity at SSTR5 (Ki approximately 7 nanomolar) and SSTR3 (Ki approximately 35 nanomolar), and negligible affinity at SSTR1 and SSTR4 [1, 2]. The compound was synthesized at the Sandoz Forschungsinstitut in Basel by Bauer, Briner, Doepfner, and colleagues in 1982, selected from a series of conformationally stabilized somatostatin fragments on the basis of a 45-fold increase in potency for growth hormone inhibition relative to somatostatin-14 in an in vitro rat pituitary bioassay and a 30-fold selectivity for growth hormone suppression over insulin suppression, a therapeutic index absent from the native tetradecapeptide [1]. The critical structural innovation was the introduction of a D-Trp at position 4 and D-phenylalanol at the C-terminus within a cystine-bridged octapeptide ring that resisted enzymatic degradation and extended the plasma elimination half-life from the approximately 1 to 3 minutes of native somatostatin to approximately 90 to 120 minutes after subcutaneous injection in humans [3, 4]. Octreotide received United States Food and Drug Administration approval in 1988 for the symptomatic management of acromegaly and for the control of symptoms associated with metastatic carcinoid tumors and vasoactive intestinal peptide-secreting tumors (VIPomas). The long-acting release (LAR) intramuscular depot microsphere formulation (Sandostatin LAR, Novartis) was approved in 1998, enabling once-monthly administration at 10, 20, or 30 milligram doses. An oral octreotide capsule formulation (Mycapssa, Chiasma/Amryt) employing a transient permeability enhancer technology received FDA approval in 2020 for long-term maintenance therapy in acromegaly patients previously responding to injectable somatostatin receptor ligands [5]. The antiproliferative activity of octreotide LAR in metastatic midgut neuroendocrine tumors was established in the PROMID trial (Rinke et al. 2009), a placebo-controlled randomized study demonstrating a median time to tumor progression of 14.3 months versus 6.0 months on placebo (hazard ratio 0.34, p equal to 0.000072) [6]. Pharmacokinetics after subcutaneous administration are characterized by rapid absorption (peak plasma concentration at 25 to 30 minutes), high bioavailability (approximately 100 percent), plasma protein binding of approximately 65 percent predominantly to lipoprotein, hepatobiliary metabolism, and renal elimination of approximately 32 percent of the dose as unchanged drug [3, 4]. The principal adverse effects are gastrointestinal (diarrhea, nausea, abdominal discomfort in 30 to 50 percent of patients, typically self-limiting), cholelithiasis (gallstone or biliary sludge formation in 15 to 30 percent on chronic therapy, attributable to inhibition of cholecystokinin-mediated gallbladder contraction and bile flow), and alterations in glucose homeostasis (suppression of insulin and glucagon secretion producing hyper- or hypoglycemia depending on the metabolic context) [7, 8]. This monograph documents the chemistry, synthesis, and structural pharmacology of octreotide; the somatostatin receptor subtype binding profile and downstream signaling; the comprehensive human pharmacokinetic record across subcutaneous, intramuscular depot, and oral formulations; the clinical evidence base across acromegaly, neuroendocrine tumors, carcinoid syndrome, VIPomas, variceal bleeding, and investigational indications; reconstitution and handling; stack-interaction considerations; the adverse-event and safety record; and a structured comparative assessment of five somatostatin-pathway agents (lanreotide, pasireotide, pegvisomant, paltusotine, lutetium-177 DOTATATE) against octreotide on five competency standards.

Read the full monograph

The full reference document covers compound identification, discovery and developmental history, mechanism of action, pharmacokinetics, sourcing and quality verification, and a curated reference list. Embedded inline below; download for offline reading.

KDC-MN-1390Open in new tab →

Download PDF →

FOR RESEARCH USE ONLY. Not for medical, diagnostic, or therapeutic purposes. Not for human consumption. All information is provided for research and educational purposes only.

May 10, 2026
Ovagen

Our opinion on this compoundSingle-lab provenance

48/100

Single-lab Khavinson hepatic tripeptide with genuinely novel mechanism claims but zero independent validation

Here’s the thing about Ovagen: the mechanism story is genuinely interesting. A tripeptide that skips receptor signaling entirely and goes straight to the nucleus to interact with DNA promoter regions and reshape chromatin state for hepatocyte gene expression. Thats a bold claim. It’s the kind of mechanism that, if independently verified, would represent something meaningfully new in the hepatoprotective space. We don’t have anything quite like it from a Western-validated source, and that’s exactly why Ovagen is worth knowing about and also why a serious investigator needs to hold the evidence lightly.

Ovagen is the liver and GI-specific member of Khavinson’s synthetic ultrashort peptide line, a tripeptide sequence Glu-Asp-Leu (EDL) at 375 daltons. The Khavinson group’s working theory is that ultrashort peptides of this size can penetrate cell membranes without receptor-mediated endocytosis, localize to the nucleoplasm, and perform sequence-specific binding at promoter regions. For Ovagen, the reported effects include roughly 18-fold increases in Ki-67 (proliferation marker) and 6-fold decreases in p53 expression in aged rat liver tissue. That’s a large signal in a senescence model. Interesting if real.

The problem is the evidence base. Its Khavinson and collaborating Russian institutions, full stop. No independent replication. No human pharmacokinetic data to Western standards. No published, peer-reviewed clinical trials. That pattern will look familiar if you’ve looked at Epitalon or Thymalin from the same program. The proposed direct peptide-DNA interaction mechanism, while theoretically compelling, hasn’t been validated by structural biology methods that Western investigators would require: ChIP-seq, ATAC-seq, or crystal structure work showing actual peptide-DNA contact geometry are all absent from the published literature. The 2021 Molecules systematic review from Khavinson’s group covers the broader framework but doesn’t resolve the replication gap.

What we like about Ovagen as a research target is the mechanistic niche. If you’re running a program on epigenetic regulation of hepatic aging, or specifically testing whether ultrashort peptides can function as nuclear-localizing chromatin remodelers, Ovagen is a probe with no close analog in the Western catalog. That’s genuine bench value, limited but real. The gastrointestinal mucosal data, specifically tight junction expression and intestinal permeability effects in aging models, adds a secondary application angle that’s independently interesting given current attention on gut-liver axis biology.

What we don’t like: you’re building entirely on one lab’s work. The 14 to 28-day carbon tetrachloride and paracetamol hepatotoxicity models show signal, but CCl4 models are notoriously permissive and many compounds look plausible there. The absence of any human pharmacokinetic or efficacy signal means translational confidence is essentially zero at present. For investigators specifically curious about the Khavinson ultrashort peptide class or the peptide-DNA interaction hypothesis as a research object, Ovagen is worth examining. For anyone who needs human-translatable evidence before committing bench resources, the score reflects where this compound actually sits.

Novelty

65

Mechanism promise

70

In-category differentiation

55

Evidence quality

20

Translational signal

18

Research bench value

38

Rationale The direct peptide-DNA chromatin remodeling story is the most mechanistically novel angle in the hepatoprotective category, but the evidence base is entirely Khavinson-consortium preclinical with no human data and no independent replication, placing it firmly in the same evidentiary tier as Epitalon. Scores elevate slightly above Epitalon on mechanism novelty but are constrained by near-zero translational signal and the same single-source provenance problem.

Editorial commentary from Kodiac biolabs. Not a recommendation, not clinical advice. Research use only.

Synthetic hepatoprotective tripeptide bioregulator of the Khavinson ultrashort peptide class

A synthetic tripeptide (Glu-Asp-Leu) developed at the Saint Petersburg Institute of Bioregulation and Gerontology as a tissue-specific epigenetic bioregulator targeting hepatic and gastrointestinal gene expression, distinguished from conventional hepatoprotective agents by a proposed mechanism of direct nuclear peptide-DNA interaction and chromatin remodeling rather than receptor-mediated signal transduction.

Abstract

Ovagen is a synthetic tripeptide composed of L-glutamic acid, L-aspartic acid, and L-leucine (Glu-Asp-Leu; single-letter code EDL) and belongs to the Khavinson class of ultrashort peptide bioregulators developed at the Saint Petersburg Institute of Bioregulation and Gerontology under the direction of Vladimir Khavinson. The compound is classified as a liver and gastrointestinal tract bioregulator within the Cytogen (synthetic short-chain peptide) product line and is proposed to exert its biological activity through direct interaction with nuclear DNA and chromatin rather than through conventional membrane receptor signaling. The molecular weight of Ovagen is 375.37 daltons (molecular formula C15H25N3O8), a size that places it within the ultrashort peptide category (2 to 7 amino acid residues) characterized by resistance to gastrointestinal peptidase degradation, oral bioavailability without enteric coating in some formulations, and the capacity to cross cellular membranes and localize to the nucleoplasm without receptor-mediated endocytosis. The principal proposed mechanism of action involves sequence-specific binding of the EDL tripeptide to double-stranded DNA in the promoter regions of hepatocyte genes governing cell proliferation, antioxidant defense, apoptosis, and inflammatory signaling. In aged rat liver tissue, Ovagen administration has been reported to produce an approximately 18-fold increase in Ki-67 expression (a marker of cellular proliferation) and an approximately 6-fold decrease in p53 expression (a marker of apoptotic signaling and cellular senescence), suggesting a shift from senescent to proliferative hepatocyte phenotype [1, 2]. In preclinical models of chemically induced hepatotoxicity (carbon tetrachloride and paracetamol), Ovagen administration over 14 to 28 days reduced serum liver enzyme elevation, decreased hepatocyte necrosis and inflammatory cell infiltration on histological examination, and normalized hepatic antioxidant status [3, 4]. A secondary research application involves gastrointestinal mucosal support, with preclinical data suggesting that Ovagen strengthens epithelial barrier function, increases tight junction protein expression, and reduces intestinal permeability in aging models [5]. The compound has not been approved by any national regulatory authority for therapeutic use. No published, peer-reviewed human clinical trials of Ovagen exist as of the date of this monograph. The evidence base is entirely preclinical (cell culture and rodent models) and is derived predominantly from the Khavinson laboratory and collaborating Russian institutions. The peptide bioregulator framework within which Ovagen was developed has produced a substantial body of Russian-language and English-language literature, including a 2021 systematic review of peptide regulation of gene expression published in the journal Molecules [6], but the framework has not been independently validated by Western regulatory-standard clinical trials. Investigators considering Ovagen for research applications should weight the evidence accordingly, noting the predominantly single-laboratory provenance of the preclinical data, the absence of human pharmacokinetic characterization to Western regulatory standards, and the mechanistic novelty of the proposed direct peptide-DNA interaction pathway. This monograph reviews the chemistry, proposed mechanism of action, preclinical pharmacology, available pharmacokinetic considerations, sourcing and quality verification, reconstitution and handling, stack-interaction considerations, adverse-event signal, and a comparative assessment of five hepatoprotective or liver-bioregulatory candidates against Ovagen on five competency standards.

Read the full monograph

The full reference document covers compound identification, discovery and developmental history, mechanism of action, pharmacokinetics, sourcing and quality verification, and a curated reference list. Embedded inline below; download for offline reading.

KDC-MN-1406Open in new tab →

Download PDF →

FOR RESEARCH USE ONLY. Not for medical, diagnostic, or therapeutic purposes. Not for human consumption. All information is provided for research and educational purposes only.

May 10, 2026
LL-37

Our opinion on this compoundEstablished, active research

62/100

The sole human cathelicidin; strong bench utility and multi-target mechanism tempered by 30-year age and Phase II-only clinical picture

Look, the first thing that matters about LL-37 is that its the only cathelicidin the human genome produces. That fact alone gives it a research anchor that no synthetic AMP analog or defensin can replicate: if you want to study human endogenous cationic antimicrobial biology, you are studying this peptide whether you like it or not. Discovered by Gudmundsson and Agerberth at the Karolinska in 1996 as FALL-39, it took a few years for the community to standardize on the LL-37 designation and really map the receptor pharmacology. That work is now mature, and the maturity is both the compound’s strength and its ceiling.

The mechanism picture is genuinely broad. Direct membrane disruption against gram-positives, gram-negatives, fungi, and enveloped viruses is the headline, but the immunomodulatory layer is what makes this interesting for bench purposes. FPR2/ALX signaling drives chemotaxis; LPS neutralization short-circuits endotoxin cascades; EGFR transactivation promotes wound re-epithelialization; and the TLR9 activation story via LL-37/self-DNA complexes in plasmacytoid dendritic cells connects directly to psoriasis pathogenesis. None of those are speculative. The vitamin D-CAMP transcriptional axis, characterized by Liu et al. 2006 in the tuberculosis context, is one of those rare mechanistic findings that opened an entire secondary research program on its own. We think thats worth noting because it means LL-37 is often a downstream readout for vitamin D biology research, not just an AMP candidate.

Clinical translation is real but incomplete. The Gothenburg group’s Phase IIb venous leg ulcer data showed healing rate constants three- to sixfold above placebo at 0.5 to 1.6 mg/mL, and the 148-patient multicenter trial identified a subgroup signal in larger ulcers exceeding 10 cm2. The Lactococcus-delivered oral LL-37 trial in SARS-CoV-2 Omicron BA.5.1.3 infection is an interesting delivery innovation that produced real viral clearance shortening with early intervention. That said, we’re still looking at Phase II endpoints across multiple indications with no Phase III confirmation anywhere, and the cancer biology findings actively contradict each other depending on tumor type.

Whats this worth to an investigator right now? Quite a bit if your research touches innate immunity, chronic wound biology, AMP mechanism, or vitamin D-infection axes. The proteolytic instability problem is itself a productive research angle: d-amino acid substitution work, nanoparticle encapsulation strategies, and protease-resistant analog design are all live areas. What we dont love is the cancer literature, which is frankly a mess of context-dependent results that make it hard to build a coherent research program around that angle specifically. Score here reflects a well-characterized, multi-mechanistic, genuinely indispensable tool compound that stopped being novel about two decades ago.

Novelty

44

Mechanism promise

68

In-category differentiation

72

Evidence quality

60

Translational signal

60

Research bench value

76

Rationale LL-37 earns real research credit on differentiation and bench value because theres genuinely nothing else like it in the human genome, and the multi-receptor pharmacology (FPR2, P2X7, TLR9, EGFR) is substantively interesting. Scoring is held back by a 1996 discovery date that drags novelty into the mid-40s and by a clinical base that tops out at Phase IIb with modest N, placing it comfortably in the established-active tier rather than novel-promising.

Editorial commentary from Kodiac biolabs. Not a recommendation, not clinical advice. Research use only.

Cathelicidin-derived cationic antimicrobial and immunomodulatory peptide

The sole human cathelicidin-derived antimicrobial peptide, a 37-residue amphipathic alpha-helical cationic peptide released from the precursor protein hCAP-18 by proteinase 3 cleavage, possessing direct broad-spectrum antimicrobial activity through membrane disruption and pleiotropic immunomodulatory functions mediated by formyl peptide receptor 2, P2X7, and toll-like receptor signaling.

Abstract

LL-37, the carboxy-terminal 37-residue peptide of human cationic antimicrobial protein 18 (hCAP-18), is the only cathelicidin-derived antimicrobial peptide identified in the human genome and is a central effector of innate immune defense across epithelial surfaces, wound repair, and inflammatory regulation. The peptide was first identified as FALL-39 by Gudmundsson, Agerberth, and colleagues at the Karolinska Institutet in 1996 through screening of a human bone marrow cDNA library [1], and the mature processed form was subsequently designated LL-37 on the basis of its amino-terminal leucine-leucine sequence and 37-residue length [2]. hCAP-18, the 18-kilodalton holoprotein precursor, is constitutively stored in the specific granules of neutrophils and is released and proteolytically processed by neutrophil-derived proteinase 3 at sites of infection and inflammation to yield the biologically active LL-37 fragment [3]. The peptide adopts an amphipathic alpha-helical conformation in membrane-mimetic environments and exerts direct antimicrobial activity against gram-positive and gram-negative bacteria, enveloped viruses, and fungi through electrostatic interaction with anionic microbial membranes followed by membrane permeabilization and disruption [4, 5]. Beyond direct microbicidal activity, LL-37 functions as a multifunctional immunomodulatory mediator: it signals through formyl peptide receptor 2 (FPR2/ALX) to recruit neutrophils, monocytes, and T cells [6]; it neutralizes bacterial lipopolysaccharide and prevents endotoxin-driven inflammatory cascades [7]; it promotes angiogenesis and wound re-epithelialization through epidermal growth factor receptor transactivation [8]; and it modulates adaptive immune responses through effects on dendritic cell maturation and T helper cell polarization [9]. Expression of hCAP-18/LL-37 is transcriptionally regulated by 1,25-dihydroxyvitamin D3 through a vitamin D response element in the CAMP gene promoter, a mechanism first characterized by Liu et al. (2006) in a landmark demonstration that toll-like receptor activation of human macrophages by Mycobacterium tuberculosis triggers CYP27B1-mediated conversion of 25-hydroxyvitamin D to the active 1,25-dihydroxy form, which then induces cathelicidin expression and intracellular killing of the mycobacterium [10]. This vitamin D-cathelicidin axis has become a major research focus in tuberculosis, respiratory infection, and immunodeficiency. Clinical translation of LL-37 has advanced through Phase I and Phase II trials in chronic wound healing, where topical application of synthetic LL-37 at 0.5 and 1.6 mg/mL produced healing rate constants approximately three- to six-fold greater than placebo in hard-to-heal venous leg ulcers [11], and through a Phase IIb multicenter trial of 148 patients that identified a subgroup benefit in ulcers exceeding 10 cm2 [12]. A randomized trial of recombinant LL-37 delivered via Lactococcus lactis as oral therapy against SARS-CoV-2 Omicron BA.5.1.3 demonstrated significant shortening of viral RNA negative conversion time with early intervention and acceptable safety [13]. The peptide is also implicated in the pathogenesis of rosacea, where aberrant processing of cathelicidin by kallikrein 5 serine protease generates proinflammatory LL-37 fragments in facial skin [14]; in psoriasis, where LL-37 complexed with self-DNA activates plasmacytoid dendritic cells through toll-like receptor 9 [15]; and in cancer biology, where context-dependent pro-tumorigenic and anti-tumorigenic effects have been reported across colorectal, breast, ovarian, and lung malignancies [16, 17]. Pharmacokinetically, the peptide is susceptible to rapid proteolytic degradation in serum with a half-life of minutes to hours depending on protease milieu, limiting systemic bioavailability and driving research toward local and topical delivery, protease-resistant analogs, d-amino acid substitutions, and nanoparticle encapsulation strategies [18, 19]. The compound is commercially available as a synthetic peptide at greater than 95 percent purity from multiple peptide synthesis suppliers. This monograph reviews the chemistry, structure, and processing of LL-37; the molecular pharmacology including direct antimicrobial mechanisms and immunomodulatory receptor signaling; the vitamin D transcriptional axis; preclinical pharmacology across infection, inflammation, and wound healing models; the clinical evidence base in chronic wounds, infectious disease, and dermatologic conditions; reconstitution and handling; stack interactions; adverse events and safety signals including the rosacea and psoriasis pathogenic associations; and a comparative assessment of five alternative antimicrobial and immunomodulatory peptide candidates against LL-37 on five competency standards.

Read the full monograph

The full reference document covers compound identification, discovery and developmental history, mechanism of action, pharmacokinetics, sourcing and quality verification, and a curated reference list. Embedded inline below; download for offline reading.

KDC-MN-1389Open in new tab →

Download PDF →

FOR RESEARCH USE ONLY. Not for medical, diagnostic, or therapeutic purposes. Not for human consumption. All information is provided for research and educational purposes only.

May 10, 2026
Encenicline

Our opinion on this compoundNiche research probe

49/100

Best-characterized alpha-7 partial agonist defines class failure but retains genuine probe value

Look, encenicline is one of the most thoroughly documented failures in cognitive pharmacology, and that’s actually what makes it interesting as a research tool. The compound arrived from Bayer’s quinuclidine benzothiophene program via EnVivo Pharmaceuticals with real selectivity advantages over earlier alpha-7 candidates like GTS-21, and it hit Phase 2 with genuine signal: Cohen’s d around 0.3 to 0.5 on cognitive composites in both schizophrenia and Alzheimer populations isn’t noise. Those 2013 to 2015 readouts looked credible enough to justify two simultaneous global Phase 3 programs, which is a meaningful scientific endorsement from the field.

Then it fell apart. CIAS-1 and CIAS-2 both missed co-primary endpoints in March 2016, the Alzheimer program was on partial clinical hold after serious GI adverse events including ulceration in a small patient fraction, and Forum Pharmaceuticals closed the same year. We think the Phase 3 failure here is more informative than most, because encenicline was arguably the best-designed compound for the hypothesis: high subtype selectivity, favorable intrinsic efficacy at 60 to 70 percent of the acetylcholine maximum in heterologous expression systems, clean oral PK, and acceptable Phase 1 tolerability up to 180 milligrams. If monoselective alpha-7 partial agonism was going to move the cognitive needle in CIAS, this compound was the one to do it.

It didn’t. What that tells you is that alpha-7 alone isnt enough at the registration threshold, at least in late-stage schizophrenia cognitive impairment or Alzheimer disease. Whether the issue is downstream receptor biology in disease tissue, target expression variability, or a fundamental ceiling on the cholinergic hypothesis in these populations, the field hasn’t resolved it. Thats actually where encenicline still earns bench time: as a probe for the question, not an answer to it.

As a reference compound, it’s the most pharmacologically characterized alpha-7 partial agonist available. The published PK record from single ascending-dose Phase 1 studies is unusually detailed, the receptor pharmacology is well-defined across multiple electrophysiological preparations, and multiple chemical suppliers carry it at greater than 98 percent purity. If you’re building a combination-pharmacology study, investigating the cholinergic anti-inflammatory pathway, or asking how alpha-7 activity interacts with other receptor systems in vitro, encenicline is a cleaner tool than GTS-21 (non-selective), tropisetron (dual MoA with 5-HT3 overlay), or AVL-3288 (positive allosteric modulator, fundamentally different pharmacology).

Honestly, the score reflects a compound that sits at the intersection of deep evidence and limited promise. Novelty is low, the class is defined by clinical failure, and the translational signal ran out at Phase 3. But the evidence base is unusually rigorous, and for any lab studying alpha-7 pharmacology seriously, encenicline is the reference standard that lets you interpret everything else in the class.

Novelty

35

Mechanism promise

45

In-category differentiation

60

Evidence quality

65

Translational signal

30

Research bench value

68

Rationale High evidence quality from two Phase 3 programs and extensive Phase 1 PK record, but CIAS-1 and CIAS-2 both missed co-primary endpoints and the partial FDA clinical hold for GI toxicity decisively limits translational signal; residual score is driven by bench probe value as the reference alpha-7 partial agonist with unusually detailed pharmacological characterization and multi-supplier availability above 98 percent purity.

Editorial commentary from Kodiac biolabs. Not a recommendation, not clinical advice. Research use only.

Selective alpha-7 nicotinic acetylcholine receptor partial agonist

A quinuclidine benzothiophene-2-carboxamide developed at EnVivo and advanced by Forum Pharmaceuticals through two global Phase 3 programs in schizophrenia cognitive impairment and one Phase 3 program in Alzheimer disease, terminated in March 2016 after both Phase 3 schizophrenia trials missed co-primary endpoints and following a September 2015 FDA clinical hold for severe gastrointestinal adverse events.

Abstract

Encenicline (development codes EVP-6124 and MT-4666) is a small-molecule selective partial agonist of the homopentameric alpha-7 subtype of the neuronal nicotinic acetylcholine receptor (alpha-7 nAChR), distinguished from earlier candidates in the class by its high subtype selectivity, the relatively favorable functional intrinsic activity profile (60 to 70 percent of the acetylcholine maximum response in heterologous expression systems), and a clinical development trajectory that reached two global Phase 3 programs in cognitive impairment associated with schizophrenia (CIAS-1 and CIAS-2) and one Phase 3 program in Alzheimer disease (COGNITIV-AD). The compound was originated at EnVivo Pharmaceuticals (later renamed Forum Pharmaceuticals) following the 2008 acquisition of the parent quinuclidine benzothiophene chemistry program from Bayer, and was advanced through Phase 1 first-in-human studies in 2010 to 2012, through positive Phase 2 schizophrenia and Alzheimer disease readouts in 2013 to 2015 with effect sizes of approximately Cohen’s d 0.3 to 0.5 on cognitive composite measures, and into the Phase 3 program from 2014. In September 2015 the United States Food and Drug Administration placed the Phase 3 schizophrenia trials and the Alzheimer disease trial on partial clinical hold following reports of severe gastrointestinal adverse events including nausea, vomiting, and gastrointestinal ulceration in a small fraction of patients; the hold was partially lifted in November 2015 to permit completion of the schizophrenia Phase 3 studies under modified safety protocols. In March 2016 Forum announced that both Phase 3 schizophrenia trials had missed their co-primary cognitive and functional endpoints and the program was discontinued. Forum Pharmaceuticals was wound down in 2016. Encenicline represents the most clinically developed alpha-7 nicotinic partial agonist in cognitive applications and is the principal source of the contemporary scientific assessment that monoselective alpha-7 partial agonism, despite robust preclinical pharmacology and Phase 2 cognitive signals, has not produced clinically meaningful improvement at the registration threshold in the indications studied. The compound remains commercially unavailable but is supplied as a research-grade reagent (greater than 98 percent purity) by multiple chemical suppliers and continues to serve as a reference alpha-7 nicotinic partial agonist for fundamental pharmacology research and for combination-pharmacology investigations. This monograph reviews the chemistry, synthesis, and stereochemistry of encenicline; the receptor pharmacology in molecular and electrophysiological detail; the comprehensive human pharmacokinetic record from single ascending-dose Phase 1 and bioavailability studies; the indication-by-indication clinical evidence base across schizophrenia cognitive impairment, Alzheimer disease, and selected exploratory cognitive endpoints; the reconstitution, sourcing, and stack-interaction considerations for laboratory work; the Phase 3 safety signal and its mechanistic interpretation; and a structured comparative assessment of five alpha-7 nicotinic acetylcholine receptor candidates against encenicline on five competency standards.

Read the full monograph

The full reference document covers compound identification, discovery and developmental history, mechanism of action, pharmacokinetics, sourcing and quality verification, and a curated reference list. Embedded inline below; download for offline reading.

KDC-MN-1352Open in new tab →

Download PDF →

FOR RESEARCH USE ONLY. Not for medical, diagnostic, or therapeutic purposes. Not for human consumption. All information is provided for research and educational purposes only.

May 10, 2026

←Previous Page

1 … 28 29 30 31 32 … 69

Bench-grade research compounds. Cited research. Verified COAs.

kodiac.bio

Explore

Shop
Monographs
Lab Results
About
Affiliate program
Affiliate handbook

Account

Cart
My account

Help

Compliance
Contact

Quarterly dispatch

New batches and new monographs only. Unsubscribe in one click.

Write to us from the contact page to join the list.

Kodiac biolabs sells research compounds for in vitro and in vivo investigative purposes only. Products are not for human or veterinary consumption. Not for medical, diagnostic, or therapeutic use. By using this site you confirm you are acquiring research compounds for research purposes only.

Kodiac biolabs is not affiliated with the U.S. Food and Drug Administration. Products are research reagents, have not been evaluated by the FDA, and are not intended to diagnose, treat, cure, or prevent any disease.

© 2026 Kodiac biolabs LLC. All rights reserved.